Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – WB (Western Blot) WB (Western Blot) (CPSF3 monoclonal antibody. Western Blot analysis of CPSF3 expression in NIH/3T3.)

Cleavage And Polyadenylation Specificity Factor Subunit 3 (CPSF3) Antibody – Mouse Monoclonal

CPSF3 (Cleavage and Polyadenylation Specificity Factor Subunit 3, Cleavage and Polyadenylation Specificity Factor 73kD Subunit, CPSF 73kD Subunit, mRNA 3'-end-processing Endonuclease CPSF-73, CPSF73) (PE)

Average rating 0.0
No ratings yet
Gene Names
CPSF3; CPSF73; CPSF-73
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CPSF3, Antibody; CPSF3 (Cleavage and Polyadenylation Specificity Factor Subunit 3, Cleavage and Polyadenylation Specificity Factor 73kD Subunit, CPSF 73kD Subunit, mRNA 3'-end-processing Endonuclease CPSF-73, CPSF73) (PE); anti-CPSF3 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E6
Specificity
Recognizes human CPSF3. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CPSF3 antibody
ELISA, IF (Immunofluorescence), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa585-685, from human CPSF3 (NP_057291) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CPSF3 monoclonal antibody. Western Blot analysis of CPSF3 expression in NIH/3T3.)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – WB (Western Blot) WB (Western Blot) (CPSF3 monoclonal antibody. Western Blot analysis of CPSF3 expression in NIH/3T3.)

WB (Western Blot)

(Western Blot analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody. Lane 1: CPSF3 transfected lysate (77.5kD). Lane 2: Non-transfected lysate.)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody. Lane 1: CPSF3 transfected lysate (77.5kD). Lane 2: Non-transfected lysate.)

Application Data

(Detection limit for recombinant GST tagged CPSF3 is ~0.1ng/ml as a capture antibody.)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – Application Data Application Data (Detection limit for recombinant GST tagged CPSF3 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CPSF3 on HeLa cell. [antibody concentration 10ug/ml].)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CPSF3 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(CPSF3 monoclonal antibody, Western Blot analysis of CPSF3 expression in Hela NE.)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – WB (Western Blot) WB (Western Blot) (CPSF3 monoclonal antibody, Western Blot analysis of CPSF3 expression in Hela NE.)

WB (Western Blot)

(CPSF3 monoclonal antibody. Western Blot analysis of CPSF3 expression in PC-12.)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – WB (Western Blot) WB (Western Blot) (CPSF3 monoclonal antibody. Western Blot analysis of CPSF3 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Mouse Anti-CPSF3 Monoclonal Antibody – Cat# AAA25651 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-CPSF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,486 Da
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 3
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 3, 73kDa
NCBI Official Symbol
CPSF3
NCBI Official Synonym Symbols
CPSF73; CPSF-73
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 3; mRNA 3'-end-processing endonuclease CPSF-73
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 3
UniProt Gene Name
CPSF3
UniProt Synonym Gene Names
CPSF73; CPSF 73 kDa subunit
UniProt Entry Name
CPSF3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CPSF3 cpsf3 (Catalog #AAA25651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CPSF3 (Cleavage and Polyadenylation Specificity Factor Subunit 3, Cleavage and Polyadenylation Specificity Factor 73kD Subunit, CPSF 73kD Subunit, mRNA 3'-end-processing Endonuclease CPSF-73, CPSF73) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CPSF3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPSF3 cpsf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPSF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.