Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24077_WB6.jpg WB (Western Blot) (Western blot analysis of CITED1 over-expressed 293 cell line, cotransfected with CITED1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with CITED1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human, Rat CITED1 Monoclonal Antibody | anti-CITED1 antibody

CITED1 (CBP/p300 Interacting Transactivator 1, Cbp/p300-interacting Transactivator with Glu/Asp-rich Carboxy-terminal Domain 1, Melanocyte-specific Protein1)

Gene Names
CITED1; MSG1
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CITED1, Antibody; CITED1 (CBP/p300 Interacting Transactivator 1, Cbp/p300-interacting Transactivator with Glu/Asp-rich Carboxy-terminal Domain 1, Melanocyte-specific Protein1); Anti -CITED1 (CBP/p300 Interacting Transactivator 1, Cbp/p300-interacting Transactivator with Glu/Asp-rich Carboxy-terminal Domain 1, Melanocyte-specific Protein1); anti-CITED1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G8
Specificity
Recognizes human CITED1. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Applicable Applications for anti-CITED1 antibody
ELISA, WB (Western Blot)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa94-193 from human CITED1 (NP_004134) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of CITED1 over-expressed 293 cell line, cotransfected with CITED1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with CITED1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24077_WB6.jpg WB (Western Blot) (Western blot analysis of CITED1 over-expressed 293 cell line, cotransfected with CITED1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with CITED1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CITED1 is ~0.3ng/ml as a capture antibody.)

product-image-AAA24077_APP5.jpg Application Data (Detection limit for recombinant GST tagged CITED1 is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody. Lane 1: CITED1 transfected lysate (19.9kD). Lane 2: Non-transfected lysate.)

product-image-AAA24077_WB4.jpg WB (Western Blot) (Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody. Lane 1: CITED1 transfected lysate (19.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CITED1 monoclonal antibody Western Blot analysis of CITED1 expression in A-431.)

product-image-AAA24077_WB3.jpg WB (Western Blot) (CITED1 monoclonal antibody Western Blot analysis of CITED1 expression in A-431.)

WB (Western Blot)

(CITED1 monoclonal antibody. Western Blot analysis of CITED1 expression in PC-12.)

product-image-AAA24077_WB2.jpg WB (Western Blot) (CITED1 monoclonal antibody. Western Blot analysis of CITED1 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA24077_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-CITED1 antibody
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-CITED1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,896 Da
NCBI Official Full Name
cbp/p300-interacting transactivator 1 isoform 1
NCBI Official Synonym Full Names
Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
NCBI Official Symbol
CITED1
NCBI Official Synonym Symbols
MSG1
NCBI Protein Information
cbp/p300-interacting transactivator 1; melanocyte-specific gene 1; melanocyte-specific protein 1
UniProt Protein Name
Cbp/p300-interacting transactivator 1
UniProt Gene Name
CITED1
UniProt Synonym Gene Names
MSG1
UniProt Entry Name
CITE1_HUMAN

Similar Products

Product Notes

The CITED1 cited1 (Catalog #AAA24077) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CITED1 (CBP/p300 Interacting Transactivator 1, Cbp/p300-interacting Transactivator with Glu/Asp-rich Carboxy-terminal Domain 1, Melanocyte-specific Protein1) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CITED1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CITED1 cited1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SMQLQKLNSQ YQGMAAATPG QPGEAGPLQN WDFGAQAGGA ESLSPSAGAQ SPAIIDSDPV DEEVLMSLVV ELGLDRANEL PELWLGQNEF DFTADFPSSC. It is sometimes possible for the material contained within the vial of "CITED1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.