Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – Application Data Application Data (Detection limit for recombinant GST tagged CHUK is 0.03 ng/ml as a capture antibody.)

Inhibitor Of Nuclear Factor Kappa-B Kinase Subunit Alpha (CHUK) Antibody – Mouse Monoclonal

CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (APC)

Average rating 0.0
No ratings yet
Gene Names
CHUK; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
CHUK, Antibody; CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (APC); conserved Helix-loop-Helix ubiquitous Kinase; IKBKA; IKK-alpha; IKK1; IKKA; NFKBIKA; TCF16; anti-CHUK antibody
Ordering

Product Overview

Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B8
Specificity
Recognizes CHUK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CHUK antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CHUK (NP_001269, 646aa-745aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged CHUK is 0.03 ng/ml as a capture antibody.)

Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – Application Data Application Data (Detection limit for recombinant GST tagged CHUK is 0.03 ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CHUK on HeLa cell. [antibody concentration 10 ug/ml])

Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CHUK on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CHUK on HeLa cell. [antibody concentration 10 ug/ml])

Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CHUK on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(CHUK monoclonal antibody (M03), clone 4B8 Western Blot analysis of CHUK expression in HeLa.)

Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – WB (Western Blot) WB (Western Blot) (CHUK monoclonal antibody (M03), clone 4B8 Western Blot analysis of CHUK expression in HeLa.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

Mouse Anti-CHUK Monoclonal Antibody – Cat# AAA26087 – Application Data Application Data (Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Related Product Information for anti-CHUK antibody
This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq]
Product Categories/Family for anti-CHUK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
84,640 Da
NCBI Official Full Name
inhibitor of nuclear factor kappa-B kinase subunit alpha
NCBI Official Synonym Full Names
conserved helix-loop-helix ubiquitous kinase
NCBI Official Symbol
CHUK
NCBI Official Synonym Symbols
IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit alpha

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CHUK (Catalog #AAA26087) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CHUK can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHUK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHUK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.