Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26692_IF6.jpg IF (Immunofluorescence) (Immunofluorescence to CDKN1B on HeLa cell using 124808 (10ug/ml).)

Mouse anti-Human CDKN1B Monoclonal Antibody | anti-CDKN1B antibody

CDKN1B (Cyclin-dependent Kinase Inhibitor 1B, Cyclin-dependent Kinase Inhibitor p27, p27Kip1, KIP1) (MaxLight 550)

Gene Names
CDKN1B; KIP1; MEN4; CDKN4; MEN1B; P27KIP1
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDKN1B, Antibody; CDKN1B (Cyclin-dependent Kinase Inhibitor 1B, Cyclin-dependent Kinase Inhibitor p27, p27Kip1, KIP1) (MaxLight 550); anti-CDKN1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B4-E6
Specificity
Recognizes human CDKN1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CDKN1B antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-198 from human CDKN1B (BC001971, AAH01971) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence to CDKN1B on HeLa cell using 124808 (10ug/ml).)

product-image-AAA26692_IF6.jpg IF (Immunofluorescence) (Immunofluorescence to CDKN1B on HeLa cell using 124808 (10ug/ml).)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between AKT1 and CDKN1B HeLa cells were stained with AKT1 rabbit purified polyclonal (1:1200) and 124808 (1:50). Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA26692_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between AKT1 and CDKN1B HeLa cells were stained with AKT1 rabbit purified polyclonal (1:1200) and 124808 (1:50). Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

IHC (Immunohistochemistry)

(Immunoperoxidase to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue using 124808 (5ug/ml).)

product-image-AAA26692_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue using 124808 (5ug/ml).)

WB (Western Blot)

(Western Blot analysis of CDKN1B expression in transfected 293T cell line by 124808 Lane 1: CDKN1B transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)

product-image-AAA26692_WB3.jpg WB (Western Blot) (Western Blot analysis of CDKN1B expression in transfected 293T cell line by 124808 Lane 1: CDKN1B transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (47.89kD).)

product-image-AAA26692_WB2.jpg WB (Western Blot) (Western Blot detection against Immunogen (47.89kD).)

Application Data

(Detection limit for 124808 is 10ng/ml as a capture antibody.)

product-image-AAA26692_APP.jpg Application Data (Detection limit for 124808 is 10ng/ml as a capture antibody.)
Product Categories/Family for anti-CDKN1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
22,073 Da
NCBI Official Full Name
Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1), mRNA
NCBI Official Synonym Full Names
cyclin dependent kinase inhibitor 1B
NCBI Official Symbol
CDKN1B
NCBI Official Synonym Symbols
KIP1; MEN4; CDKN4; MEN1B; P27KIP1
NCBI Protein Information
cyclin-dependent kinase inhibitor 1B

Similar Products

Product Notes

The CDKN1B (Catalog #AAA26692) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDKN1B (Cyclin-dependent Kinase Inhibitor 1B, Cyclin-dependent Kinase Inhibitor p27, p27Kip1, KIP1) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN1B can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDKN1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDKN1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.