Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25349_WB7.jpg WB (Western Blot) (CDK6 monoclonal antibody, Western Blot analysis of CDK6 expression in Jurkat.)

Mouse anti-Human, Rat CDK6 Monoclonal Antibody | anti-CDK6 antibody

CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (HRP)

Gene Names
CDK6; MCPH12; PLSTIRE
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDK6, Antibody; CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (HRP); anti-CDK6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8H4
Specificity
Recognizes human CDK6. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CDK6 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-99 from human CDK6 (NP_001250) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CDK6 monoclonal antibody, Western Blot analysis of CDK6 expression in Jurkat.)

product-image-AAA25349_WB7.jpg WB (Western Blot) (CDK6 monoclonal antibody, Western Blot analysis of CDK6 expression in Jurkat.)

WB (Western Blot)

(CDK6 monoclonal antibody. Western Blot analysis of CDK6 expression in PC-12.)

product-image-AAA25349_WB6.jpg WB (Western Blot) (CDK6 monoclonal antibody. Western Blot analysis of CDK6 expression in PC-12.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK2 and CDK6 HeLa cells were stained with CDK2 rabbit purified polyclonal 1:1200 and CDK6 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA25349_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK2 and CDK6 HeLa cells were stained with CDK2 rabbit purified polyclonal 1:1200 and CDK6 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25349_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

product-image-AAA25349_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody. Lane 1: CDK6 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

product-image-AAA25349_WB2.jpg WB (Western Blot) (Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody. Lane 1: CDK6 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.41kD).)

product-image-AAA25349_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.41kD).)
Product Categories/Family for anti-CDK6 antibody
References
1. APRIL promotes cell-cycle progression in primary multiple myeloma cells: influence of D-type cyclin group and translocation status. Quinn J, Glassford J, Percy L, Munson P, Marafioti T, Rodriguez-Justo M, Yong K.Blood. 2011 Jan 20;117(3):890-901. Epub 2010 Aug 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,938 Da
NCBI Official Full Name
cyclin-dependent kinase 6
NCBI Official Synonym Full Names
cyclin-dependent kinase 6
NCBI Official Symbol
CDK6
NCBI Official Synonym Symbols
MCPH12; PLSTIRE
NCBI Protein Information
cyclin-dependent kinase 6
UniProt Protein Name
Cyclin-dependent kinase 6
UniProt Gene Name
CDK6
UniProt Synonym Gene Names
CDKN6
UniProt Entry Name
CDK6_HUMAN

Similar Products

Product Notes

The CDK6 cdk6 (Catalog #AAA25349) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (HRP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDK6 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDK6 cdk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.