Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24162_WB7.jpg WB (Western Blot) (CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.)

Mouse anti-Human, Mouse CDADC1 Monoclonal Antibody | anti-CDADC1 antibody

CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) (AP)

Gene Names
CDADC1; NYD-SP15; bA103J18.1
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDADC1, Antibody; CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) (AP); anti-CDADC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A2
Specificity
Recognizes human CDADC1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CDADC1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa423-515 from human CDADC1 (NP_112173) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.)

product-image-AAA24162_WB7.jpg WB (Western Blot) (CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.)

WB (Western Blot)

(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in Raw 264.7.)

product-image-AAA24162_WB6.jpg WB (Western Blot) (CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in Raw 264.7.)

WB (Western Blot)

(Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24162_WB5.jpg WB (Western Blot) (Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CDADC1 is ~0.03ng/ml as a capture antibody.)

product-image-AAA24162_APP4.jpg Application Data (Detection limit for recombinant GST tagged CDADC1 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].)

product-image-AAA24162_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].)

WB (Western Blot)

(Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody. Lane 1: CDADC1 transfected lysate (58.5kD). Lane 2: Non-transfected lysate.)

product-image-AAA24162_WB2.jpg WB (Western Blot) (Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody. Lane 1: CDADC1 transfected lysate (58.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.23kD).)

product-image-AAA24162_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.23kD).)
Product Categories/Family for anti-CDADC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
cytidine and dCMP deaminase domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
cytidine and dCMP deaminase domain containing 1
NCBI Official Symbol
CDADC1
NCBI Official Synonym Symbols
NYD-SP15; bA103J18.1
NCBI Protein Information
cytidine and dCMP deaminase domain-containing protein 1
UniProt Protein Name
Cytidine and dCMP deaminase domain-containing protein 1
UniProt Gene Name
CDADC1
UniProt Entry Name
CDAC1_HUMAN

Similar Products

Product Notes

The CDADC1 cdadc1 (Catalog #AAA24162) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CDADC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDADC1 cdadc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDADC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.