Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using [KO Validated] Beclin 1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

Tubulin Beta-3 Chain Isoform 2 (Beclin1) Antibody – Rabbit Monoclonal

[KO Validated] Beclin 1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TUBB3; CDCBM; TUBB4; beta-4; CFEOM3A
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Beclin 1, Antibody; [KO Validated] Beclin 1 Rabbit pAb; BECN1; ATG6; VPS30; beclin1; beclin-1; anti-Beclin1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b, kappa
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
Applicable Applications for anti-Beclin1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF/ICC: 1:50-1:200
Positive Samples
293T, HeLa, U-87MG, Mouse lung, Mouse testis, Mouse spleen, Rat lung
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).
Cellular Location
Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus, Mitochondrion, Mitochondrion membrane, Nucleus, Peripheral membrane protein, autophagosome, trans-Golgi network membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using [KO Validated] Beclin 1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using [KO Validated] Beclin 1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Beclin 1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Beclin 1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using Beclin 1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using Beclin 1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human stomach using Beclin 1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human stomach using Beclin 1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts from wild type (WT) and Beclin 1 knockout (KO) 293T cells, using Beclin 1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – WB (Western Blot) WB (Western Blot) (Western blot analysis of extracts from wild type (WT) and Beclin 1 knockout (KO) 293T cells, using Beclin 1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Beclin 1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – WB (Western Blot) WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Beclin 1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Beclin 1 antibody (A7353) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Rabbit Anti-Beclin1 Monoclonal Antibody – Cat# AAA28406 – WB (Western Blot) WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Beclin 1 antibody (A7353) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-Beclin1 antibody
This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,433 Da
NCBI Official Full Name
tubulin beta-3 chain isoform 2
NCBI Official Synonym Full Names
tubulin, beta 3 class III
NCBI Official Symbol
TUBB3
NCBI Official Synonym Symbols
CDCBM; TUBB4; beta-4; CFEOM3A
NCBI Protein Information
tubulin beta-3 chain; tubulin beta-III; tubulin beta-4 chain; class III beta-tubulin
UniProt Protein Name
Tubulin beta-3 chain
UniProt Gene Name
TUBB3
UniProt Synonym Gene Names
TUBB4
UniProt Entry Name
TBB3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The Beclin1 tubb3 (Catalog #AAA28406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Beclin 1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Beclin 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry). WB: 1:500-1:2000 IHC: 1:50-1:100 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the Beclin1 tubb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDLQLERISV YYNEASSHKY VPRAILVDLE PGTMDSVRSG AFGHLFRPDN FIFGQSGAGN NWAKGHYTEG AELVDSVLDV VRKECENCDC LQGFQLTHSL GGGTGSGMGT LLISKVREEY PDRIMNTFSV VPSPKVSDTV VEPYNATLSI HQLVENTDET YCIDNEALYD ICFRTLKLAT PTYGDLNHLV SATMSGVTTS LRFPGQLNAD LRKLAVNMVP F. It is sometimes possible for the material contained within the vial of "Beclin 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.