Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Apoptosis Facilitator Bcl-2-Like Protein 14 (BCL2L14) Antibody – Rabbit Monoclonal

BCL2L14/BCLG Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
BCL2L14/BCLG, Antibody; BCL2L14/BCLG Rabbit mAb; BCLG; BCL2L14/BCLG; anti-BCL2L14 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTIT
Applicable Applications for anti-BCL2L14 antibody
WB (Western Blot), IHC (Immunohistochemistry), ELISA
Application Notes
WB: 1:500-1:1000
IHC-P: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human BCL2L14/BCLG (Q9BZR8).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using BCL2L14/BCLG Rabbit mAb (AAA28501) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using BCL2L14/BCLG Rabbit mAb (AAA28501) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates using BCL2L14/BCLG Rabbit mAb (AAA28501) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of various lysates using BCL2L14/BCLG Rabbit mAb (AAA28501) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit Anti-BCL2L14 Monoclonal Antibody – Cat# AAA28501 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates using BCL2L14/BCLG Rabbit mAb (AAA28501) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-BCL2L14 antibody
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene.
Product Categories/Family for anti-BCL2L14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 37kDa
Observed MW: 37kDa
UniProt Protein Name
Apoptosis facilitator Bcl-2-like protein 14
UniProt Gene Name
BCL2L14
UniProt Synonym Gene Names
BCLG; Bcl2-L-14
UniProt Entry Name
B2L14_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The BCL2L14 bcl2l14 (Catalog #AAA28501) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL2L14/BCLG Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL2L14/BCLG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ELISA. WB: 1:500-1:1000 IHC-P: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the BCL2L14 bcl2l14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCSTSGCDLE EIPLDDDDLN TIEFKILAYY TRHHVFKSTP ALFSPKLLRT RSLSQRGLGN CSANESWTEV SWPCRNSQSS EKAINLGKKK SSWKAFFGVV EKEDSQSTPA KVSAQGQRTL EYQDSHSQQW SRCLSNVEQC LEHEAVDPKV ISIANRVAEI VYSWPPPQAT QAGGFKSKEI FVTEGLSFQL QGHVPVASSS KKDEEEQILA KIVELLKYSG DQLERKLKKD KALMGHFQDG LSYSVFKTIT. It is sometimes possible for the material contained within the vial of "BCL2L14/BCLG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.