Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – WB (Western Blot) WB (Western Blot) (BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.)

BCL2-Associated Athanogene Isoform 1L (BAG1) Antibody – Mouse Monoclonal

BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
BAG1; HAP; BAG-1; RAP46
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAG1, Antibody; BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) (Biotin); anti-BAG1 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D3
Specificity
Recognizes human BAG1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BAG1 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 35ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – WB (Western Blot) WB (Western Blot) (BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.29kD).)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.29kD).)

WB (Western Blot)

(Western Blot analysis of BAG1 expression in Jurkat using 123805.)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of BAG1 expression in Jurkat using 123805.)

Application Data

(Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – Application Data Application Data (Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of 123805 (35ug/ml) on HeLa cell.)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of 123805 (35ug/ml) on HeLa cell.)

IHC (Immunohistochemistry)

(Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.)

WB (Western Blot)

(Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.)

Mouse Anti-BAG1 Monoclonal Antibody – Cat# AAA24736 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.)
Product Categories/Family for anti-BAG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
573
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,989 Da
NCBI Official Full Name
BCL2-associated athanogene isoform 1L
NCBI Official Synonym Full Names
BCL2-associated athanogene
NCBI Official Symbol
BAG1
NCBI Official Synonym Symbols
HAP; BAG-1; RAP46
NCBI Protein Information
BAG family molecular chaperone regulator 1; Bcl-2-binding protein; receptor-associated protein, 46-KD; Bcl-2 associating athanogene-1 protein; glucocortoid receptor-associated protein RAP46
UniProt Protein Name
BAG family molecular chaperone regulator 1
UniProt Gene Name
BAG1
UniProt Synonym Gene Names
HAP; BAG-1
UniProt Entry Name
BAG1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The BAG1 bag1 (Catalog #AAA24736) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BAG1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 35ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAG1 bag1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.