Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25610_APP7.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between PRKCZ and AKT3. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and anti-AKT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse AKT3 Monoclonal Antibody | anti-AKT3 antibody

AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (PE)

Average rating 0.0
No ratings yet
Gene Names
AKT3; MPPH; PKBG; MPPH2; PRKBG; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKT3, Antibody; AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (PE); anti-AKT3 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E11
Specificity
Recognizes human AKT3. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1708
Applicable Applications for anti-AKT3 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa100-189 from AKT3 (AAD29089) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Proximity Ligation Analysis of protein-protein interactions between PRKCZ and AKT3. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and anti-AKT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA25610_APP7.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between PRKCZ and AKT3. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and anti-AKT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Detection limit for recombinant GST tagged AKT3 is ~0.03ng/ml as a capture antibody.)

product-image-AAA25610_APP6.jpg Application Data (Detection limit for recombinant GST tagged AKT3 is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in MCF-7.)

product-image-AAA25610_WB5.jpg WB (Western Blot) (AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in MCF-7.)

WB (Western Blot)

(AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in Raw 264.7.)

product-image-AAA25610_WB4.jpg WB (Western Blot) (AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in Raw 264.7.)

WB (Western Blot)

(AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in PC-12.)

product-image-AAA25610_WB3.jpg WB (Western Blot) (AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in PC-12.)

WB (Western Blot)

(AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in HeLa.)

product-image-AAA25610_WB2.jpg WB (Western Blot) (AKT3 monoclonal antibody Western Blot analysis of AKT3 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.53kD).)

product-image-AAA25610_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.53kD).)
Related Product Information for anti-AKT3 antibody
AIK3 is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1).
Product Categories/Family for anti-AKT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Homo sapiens protein kinase B gamma mRNA, complete cds
NCBI Official Synonym Full Names
AKT serine/threonine kinase 3
NCBI Official Symbol
AKT3
NCBI Official Synonym Symbols
MPPH; PKBG; MPPH2; PRKBG; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma
NCBI Protein Information
RAC-gamma serine/threonine-protein kinase
UniProt Protein Name
RAC-gamma serine/threonine-protein kinase
UniProt Gene Name
AKT3
UniProt Synonym Gene Names
PKBG; PKB gamma
UniProt Entry Name
AKT3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AKT3 akt3 (Catalog #AAA25610) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AKT3 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKT3 akt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.