Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – WB (Western Blot) WB (Western Blot) (AKAP10 monoclonal antibody Western Blot analysis of AKAP10 expression in Raw 264.7.)

A-Kinase Anchor Protein 10, Mitochondrial Isoform 1 (AKAP10) Antibody – Mouse Monoclonal

AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) APC

Average rating 0.0
No ratings yet
Gene Names
AKAP10; PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP10, Antibody; AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) APC; anti-AKAP10 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8C10
Specificity
Recognizes human AKAP10. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-AKAP10 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 0.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from AKAP10 (NP_009133) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(AKAP10 monoclonal antibody Western Blot analysis of AKAP10 expression in Raw 264.7.)

Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – WB (Western Blot) WB (Western Blot) (AKAP10 monoclonal antibody Western Blot analysis of AKAP10 expression in Raw 264.7.)

WB (Western Blot)

(RNAi Knockdown: Western blot analysis of AKAP10-over-expressing 293 cell line, cotransfected with AKAP10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with Cat. # 123131. GAPDH (36.1kD) used as specificity and loading control.)

Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – WB (Western Blot) WB (Western Blot) (RNAi Knockdown: Western blot analysis of AKAP10-over-expressing 293 cell line, cotransfected with AKAP10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with Cat. # 123131. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged AKAP10 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – Application Data Application Data (Detection limit for recombinant GST tagged AKAP10 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase staining of AKAP10 on formalin-fixed paraffin-embedded human testis using Cat. # 123131 at 0.5ug/ml.)

Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase staining of AKAP10 on formalin-fixed paraffin-embedded human testis using Cat. # 123131 at 0.5ug/ml.)

WB (Western Blot)

(Western Blot analysis of AKAP10 expression in transfected 293T cell line using Cat. # 123131: Lane 1: AKAP10 transfected lysate (73.8kD); Lane 2: Non-transfected lysate.)

Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of AKAP10 expression in transfected 293T cell line using Cat. # 123131: Lane 1: AKAP10 transfected lysate (73.8kD); Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Mouse Anti-AKAP10 Monoclonal Antibody – Cat# AAA24425 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-AKAP10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
A-kinase anchor protein 10, mitochondrial isoform 1
NCBI Official Synonym Full Names
A-kinase anchoring protein 10
NCBI Official Symbol
AKAP10
NCBI Official Synonym Symbols
PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
NCBI Protein Information
A-kinase anchor protein 10, mitochondrial
UniProt Protein Name
A-kinase anchor protein 10, mitochondrial
UniProt Gene Name
AKAP10
UniProt Synonym Gene Names
AKAP-10; D-AKAP-2; PRKA10
UniProt Entry Name
AKA10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The AKAP10 akap10 (Catalog #AAA24425) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP10 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 0.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP10 akap10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.