Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28504_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

Rabbit anti-Human AIF Monoclonal Antibody | anti-AIFM1 antibody

AIF Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
AIF, Antibody; AIF Rabbit mAb; AIF; AUNX1; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6; SEMDHL; anti-AIFM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
RRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAV
Applicable Applications for anti-AIFM1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:1000-1:4000
IHC-P: 1:200-1:800
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 450-550 of human AIF (O95831).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28504_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using AIF Rabbit mAb (AAA28504) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using AIF Rabbit mAb (AAA28504) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28504_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using AIF Rabbit mAb (AAA28504) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-AIFM1 antibody
This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and cognitive disability. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 67kDa
Observed MW: 67kDa
UniProt Protein Name
Apoptosis-inducing factor 1, mitochondrial
UniProt Gene Name
AIFM1
UniProt Synonym Gene Names
AIF; PDCD8
UniProt Entry Name
AIFM1_HUMAN

Similar Products

Product Notes

The AIFM1 aifm1 (Catalog #AAA28504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AIF Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:1000-1:4000 IHC-P: 1:200-1:800 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the AIFM1 aifm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRVEHHDHAV VSGRLAGENM TGAAKPYWHQ SMFWSDLGPD VGYEAIGLVD SSLPTVGVFA KATAQDNPKS ATEQSGTGIR SESETESEAS EITIPPSTPA V. It is sometimes possible for the material contained within the vial of "AIF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.