Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24130_APP7.jpg Application Data

Mouse anti-Human AHR Monoclonal Antibody | anti-AHR antibody

AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bHLHe76, BHLHE76) (AP)

Gene Names
AHR; bHLHe76
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AHR, Antibody; AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bHLHe76, BHLHE76) (AP); anti-AHR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B12
Specificity
Recognizes human AHR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-AHR antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa721-820 from human AHR (NP_001612) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

product-image-AAA24130_APP7.jpg Application Data

Application Data

product-image-AAA24130_APP6.jpg Application Data

Application Data

(Detection limit for 123091 is ~0.03ng/ml as a capture antibody.)

product-image-AAA24130_APP5.jpg Application Data (Detection limit for 123091 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence to AHR on HeLa cell using 123091 (10ug/ml).)

product-image-AAA24130_IF4.jpg IF (Immunofluorescence) (Immunofluorescence to AHR on HeLa cell using 123091 (10ug/ml).)

IP (Immunoprecipitation)

(Immunoprecipitation of AHR transfected lysate using 123091 and Protein A Magnetic Bead and immunoblotted with AHR rabbit polyclonal antibody.)

product-image-AAA24130_IP3.jpg IP (Immunoprecipitation) (Immunoprecipitation of AHR transfected lysate using 123091 and Protein A Magnetic Bead and immunoblotted with AHR rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 123091. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24130_WB2.jpg WB (Western Blot) (Western Blot analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 123091. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(Western Blot detection against immunogen (36.74kD).)

product-image-AAA24130_WB.jpg WB (Western Blot) (Western Blot detection against immunogen (36.74kD).)
Related Product Information for anti-AHR antibody
Aryl hydrocarbon receptor is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450.
Product Categories/Family for anti-AHR antibody
References
1. Malassezia-derived indoles activate the aryl hydrocarbon receptor and inhibit Toll-like receptor-induced maturation in monocyte-derived dendritic cells. Vlachos C, Schulte BM, Magiatis P, Adema GJ, Gaitanis G.Br J Dermatol. 2012 Apr 25. doi: 10.1111/j.1365-2133.2012.11014.x. 2. Diminished carcinogen detoxification is a novel mechanism for hypoxia-inducible factor 1-mediated genetic instability. Schults MA, Timmermans L, Godschalk RW, Theys J, Wouters BG, van Schooten FJ, Chiu RK.J Biol Chem. 2010 May 7;285(19):14558-64. Epub 2010 Mar 12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
196
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96,147 Da
NCBI Official Full Name
aryl hydrocarbon receptor
NCBI Official Synonym Full Names
aryl hydrocarbon receptor
NCBI Official Symbol
AHR
NCBI Official Synonym Symbols
bHLHe76
NCBI Protein Information
aryl hydrocarbon receptor; AH-receptor; ah receptor; aromatic hydrocarbon receptor; class E basic helix-loop-helix protein 76
UniProt Protein Name
Aryl hydrocarbon receptor
UniProt Gene Name
AHR
UniProt Synonym Gene Names
BHLHE76; Ah receptor; AhR; bHLHe76
UniProt Entry Name
AHR_HUMAN

Similar Products

Product Notes

The AHR ahr (Catalog #AAA24130) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bHLHe76, BHLHE76) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AHR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AHR ahr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AHR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.