Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (ADPGK monoclonal antibody. Western Blot analysis of ADPGK expression in Raw 264.7.)

ADP-Dependent Glucokinase (ADPGK) Antibody – Mouse Monoclonal

ADPGK (ADP-dependent Glucokinase, ADP-GK, RbBP-35, PSEC0260, 2610017G09Rik, DKFZp434B195) (PE)

Average rating 0.0
No ratings yet
Gene Names
ADPGK; ADP-GK; 2610017G09Rik
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADPGK, Antibody; ADPGK (ADP-dependent Glucokinase, ADP-GK, RbBP-35, PSEC0260, 2610017G09Rik, DKFZp434B195) (PE); ADPGK; anti-ADPGK antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E4
Specificity
Recognizes human ADPGK. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ADPGK antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa425-497 from human ADPGK (NP_112574) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(ADPGK monoclonal antibody. Western Blot analysis of ADPGK expression in Raw 264.7.)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (ADPGK monoclonal antibody. Western Blot analysis of ADPGK expression in Raw 264.7.)

WB (Western Blot)

(ADPGK monoclonal antibody, Western Blot analysis of ADPGK expression in HeLa.)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (ADPGK monoclonal antibody, Western Blot analysis of ADPGK expression in HeLa.)

WB (Western Blot)

(Western blot analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (Western blot analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged ADPGK is 0.3ng/ml as a capture antibody.)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – Application Data Application Data (Detection limit for recombinant GST tagged ADPGK is 0.3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody. Lane 1: ADPGK transfected lysate (54.1kD). Lane 2: Non-transfected lysate.)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody. Lane 1: ADPGK transfected lysate (54.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ADPGK monoclonal antibody. Western Blot analysis of ADPGK expression in NIH/3T3.)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (ADPGK monoclonal antibody. Western Blot analysis of ADPGK expression in NIH/3T3.)

WB (Western Blot)

(Western Blot detection against Immunogen (34.03kD).)

Mouse Anti-ADPGK Monoclonal Antibody – Cat# AAA25600 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (34.03kD).)
Related Product Information for anti-ADPGK antibody
Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency.
Product Categories/Family for anti-ADPGK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,252 Da
NCBI Official Full Name
ADP-dependent glucokinase
NCBI Official Synonym Full Names
ADP-dependent glucokinase
NCBI Official Symbol
ADPGK
NCBI Official Synonym Symbols
ADP-GK; 2610017G09Rik
NCBI Protein Information
ADP-dependent glucokinase; ATP-dependent glucokinase; rbBP-35
UniProt Protein Name
ADP-dependent glucokinase
UniProt Gene Name
ADPGK
UniProt Synonym Gene Names
ADP-GK; ADPGK
UniProt Entry Name
ADPGK_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ADPGK adpgk (Catalog #AAA25600) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADPGK (ADP-dependent Glucokinase, ADP-GK, RbBP-35, PSEC0260, 2610017G09Rik, DKFZp434B195) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADPGK can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADPGK adpgk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADPGK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.