Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of Hep G2 cells using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

Long-Chain-Fatty-Acid - Coa Ligase 1 (ACSL1) Antibody – Rabbit Monoclonal

ACSL1 Rabbit PolymAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
ACSL1, Antibody; ACSL1 Rabbit PolymAb; ACS1; LACS; FACL1; FACL2; LACS1; LACS2; anti-ACSL1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGI
Applicable Applications for anti-ACSL1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
WB: 1:15000-1:60000
IHC-P: 1:400-1:4000
IF/ICC: 1:800-1:3200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACSL1 (NP_001986.2)
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of Hep G2 cells using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of Hep G2 cells using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human liver tissue using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human liver tissue using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse liver tissue using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse liver tissue using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat liver tissue using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat liver tissue using ACSL1 Rabbit PolymAb® (A22737-PM, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using ACSL1 Rabbit PolymAb® (AAA28557) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using ACSL1 Rabbit PolymAb® (AAA28557) at 1:15000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit Anti-ACSL1 Monoclonal Antibody – Cat# AAA28557 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates using ACSL1 Rabbit PolymAb® (AAA28557) at 1:15000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-ACSL1 antibody
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 78kDa
Observed MW: 78kDa
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 1
UniProt Gene Name
ACSL1
UniProt Synonym Gene Names
FACL1; FACL2; LACS; LACS1; LACS2; ACS1; LACS 1; LACS 2
UniProt Entry Name
ACSL1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ACSL1 acsl1 (Catalog #AAA28557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACSL1 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. WB: 1:15000-1:60000 IHC-P: 1:400-1:4000 IF/ICC: 1:800-1:3200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ACSL1 acsl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQAHELFRYF RMPELVDFRQ YVRTLPTNTL MGFGAFAALT TFWYATRPKP LKPPCDLSMQ SVEVAGSGGA RRSALLDSDE PLVYFYDDVT TLYEGFQRGI. It is sometimes possible for the material contained within the vial of "ACSL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.