Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – WB (Western Blot) WB (Western Blot) (Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

ABL2 Protein (ABL2) Antibody – Mouse Monoclonal

ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG) (FITC)

Average rating 0.0
No ratings yet
Gene Names
ABL2; ARG; ABLL
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABL2, Antibody; ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG) (FITC); anti-ABL2 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D5
Specificity
Recognizes human ABL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1167
Applicable Applications for anti-ABL2 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa743-842 from human ABL2 (AAH65912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – WB (Western Blot) WB (Western Blot) (Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and ABL2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – Application Data Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and ABL2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged ABL2 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – Application Data Application Data (Detection limit for recombinant GST tagged ABL2 is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody. Lane 1: ABL2 transfected lysate (126.7kD). Lane 2: Non-transfected lysate.)

Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody. Lane 1: ABL2 transfected lysate (126.7kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ABL2 monoclonal antibody Western Blot analysis of ABL2 expression in Hela NE.)

Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – WB (Western Blot) WB (Western Blot) (ABL2 monoclonal antibody Western Blot analysis of ABL2 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (37kD).)

Mouse Anti-ABL2 Monoclonal Antibody – Cat# AAA25003 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-ABL2 antibody
ABL2 is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. ABL2 is expressed in both normal and tumor cells.
Product Categories/Family for anti-ABL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
27
NCBI Official Full Name
ABL2 protein
NCBI Official Synonym Full Names
ABL proto-oncogene 2, non-receptor tyrosine kinase
NCBI Official Symbol
ABL2
NCBI Official Synonym Symbols
ARG; ABLL
NCBI Protein Information
tyrosine-protein kinase ABL2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ABL2 (Catalog #AAA25003) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABL2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.