Collagenase 3 Preproprotein (MMP13) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Collagenase 3
Gene Names
MMP13; CLG3; MANDP1; MMP-13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagenase 3; N/A; Recombinant Human Collagenase 3; Matrix metalloproteinase-13; MMP-13; MMP13 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
104-471. Full Length of Mature Protein
Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for MMP13 recombinant protein
Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
Product Categories/Family for MMP13 recombinant protein
References
Molecular cloning and expression of collagenase-3, a novel human matrix metalloproteinase produced by breast carcinomas.Freije J.M.P., Diez-Itza I., Balbin M., Sanchez L.M., Blasco R., Tolivia J., Lopez-Otin C.J. Biol. Chem. 269:16766-16773(1994) A matrix metalloproteinase gene expressed in human T lymphocytes is identical with collagenase 3 from breast carcinomas.Willmroth F., Peter H.H., Conca W.Immunobiology 198:375-384(1998) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) NIEHS SNPs program Biochemical characterization of human collagenase-3.Knaeuper V., Lopez-Otin C., Smith B., Knight G., Murphy G.J. Biol. Chem. 271:1544-1550(1996) Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme.Knaeuper V., Will H., Lopez-Otin C., Smith B., Atkinson S.J., Stanton H., Hembry R.M., Murphy G.J. Biol. Chem. 271:17124-17131(1996) Degradation of cartilage aggrecan by collagenase-3 (MMP-13) .Fosang A.J., Last K., Knaeuper V., Murphy G., Neame P.J.FEBS Lett. 380:17-20(1996) Cytokine control of interstitial collagenase and collagenase-3 gene expression in human chondrocytes.Borden P., Solymar D., Sucharczuk A., Lindman B., Cannon P., Heller R.A.J. Biol. Chem. 271:23577-23581(1996) Collagenase-3 (MMP-13) is expressed by hypertrophic chondrocytes, periosteal cells, and osteoblasts during human fetal bone development.Johansson N., Saarialho-Kere U., Airola K., Herva R., Nissinen L., Westermarck J., Vuorio E., Heino J., Kaehaeri V.M.3.0.CO;2-E>Dev. Dyn. 208:387-397(1997) The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.Knaeuper V., Cowell S., Smith B., Lopez-Otin C., O'Shea M., Morris H., Zardi L., Murphy G.J. Biol. Chem. 272:7608-7616(1997) A secreted tyrosine kinase acts in the extracellular environment.Bordoli M.R., Yum J., Breitkopf S.B., Thon J.N., Italiano J.E. Jr., Xiao J., Worby C., Wong S.K., Lin G., Edenius M., Keller T.L., Asara J.M., Dixon J.E., Yeo C.Y., Whitman M.Cell 158:1033-1044(2014) The helping hand of collagenase-3 (MMP-13) 2.7 A crystal structure of its C-terminal haemopexin-like domain.Gomis-Rueth F.-X., Gohlke U., Betz M., Knaeuper V., Murphy G., Lopez-Otin C., Bode W.J. Mol. Biol. 264:556-566(1996) Crystal structures of MMP-1 and -13 reveal the structural basis for selectivity of collagenase inhibitors.Lovejoy B., Welch A.R., Carr S., Luong C., Broka C., Hendricks R.T., Campbell J.A., Walker K.A., Martin R., Van Wart H., Browner M.F.Nat. Struct. Biol. 6:217-221(1999) Solution structure of the catalytic domain of human collagenase-3 (MMP-13) complexed to a potent non-peptidic sulfonamide inhibitor binding comparison with stromelysin-1 and collagenase-1.Zhang X., Gonnella N.C., Koehn J., Pathak N., Ganu V., Melton R., Parker D., Hu S.I., Nam K.Y.J. Mol. Biol. 301:513-524(2000) High-resolution solution structure of the catalytic fragment of human collagenase-3 (MMP-13) complexed with a hydroxamic acid inhibitor.Moy F.J., Chanda P.K., Chen J.M., Cosmi S., Edris W., Levin J.I., Powers R.J. Mol. Biol. 302:671-689(2000) Potent pyrimidinetrione-based inhibitors of MMP-13 with enhanced selectivity over MMP-14.Blagg J.A., Noe M.C., Wolf-Gouveia L.A., Reiter L.A., Laird E.R., Chang S.P., Danley D.E., Downs J.T., Elliott N.C., Eskra J.D., Griffiths R.J., Hardink J.R., Haugeto A.I., Jones C.S., Liras J.L., Lopresti-Morrow L.L., Mitchell P.G., Pandit J., Robinson R.P., Subramanyam C., Vaughn-Bowser M.L., Yocum S.A.Bioorg. Med. Chem. Lett. 15:1807-1810(2005) Structural basis for the highly selective inhibition of MMP-13.Engel C.K., Pirard B., Schimanski S., Kirsch R., Habermann J., Klingler O., Schlotte V., Weithmann K.U., Wendt K.U.Chem. Biol. 12:181-189(2005) Discovery and characterization of a novel inhibitor of matrix metalloprotease-13 that reduces cartilage damage in vivo without joint fibroplasia side effects.Johnson A.R., Pavlovsky A.G., Ortwine D.F., Prior F., Man C.F., Bornemeier D.A., Banotai C.A., Mueller W.T., McConnell P., Yan C., Baragi V., Lesch C., Roark W.H., Wilson M., Datta K., Guzman R., Han H.K., Dyer R.D.J. Biol. Chem. 282:27781-27791(2007) Flexibility and variability of TIMP binding X-ray structure of the complex between collagenase-3/MMP-13 and TIMP-2.Maskos K., Lang R., Tschesche H., Bode W.J. Mol. Biol. 366:1222-1231(2007) Discovery of potent, selective, and orally active carboxylic acid based inhibitors of matrix metalloproteinase-13.Monovich L.G., Tommasi R.A., Fujimoto R.A., Blancuzzi V., Clark K., Cornell W.D., Doti R., Doughty J., Fang J., Farley D., Fitt J., Ganu V., Goldberg R., Goldstein R., Lavoie S., Kulathila R., Macchia W., Parker D.T., Melton R., O'Byrne E., Pastor G., Pellas T., Quadros E., Reel N., Roland D.M., Sakane Y., Singh H., Skiles J., Somers J., Toscano K., Wigg A., Zhou S., Zhu L., Shieh W.C., Xue S., McQuire L.W.J. Med. Chem. 52:3523-3538(2009) Discovery of (pyridin-4-yl) -2H-tetrazole as a novel scaffold to identify highly selective matrix metalloproteinase-13 inhibitors for the treatment of osteoarthritis.Schnute M.E., O'Brien P.M., Nahra J., Morris M., Howard Roark W., Hanau C.E., Ruminski P.G., Scholten J.A., Fletcher T.R., Hamper B.C., Carroll J.N., Patt W.C., Shieh H.S., Collins B., Pavlovsky A.G., Palmquist K.E., Aston K.W., Hitchcock J., Rogers M.D., McDonald J., Johnson A.R., Munie G.E., Wittwer A.J., Man C.F., Settle S.L., Nemirovskiy O., Vickery L.E., Agawal A., Dyer R.D., Sunyer T.Bioorg. Med. Chem. Lett. 20:576-580(2010) Orally active MMP-1 sparing alpha-tetrahydropyranyl and alpha-piperidinyl sulfone matrix metalloproteinase (MMP) inhibitors with efficacy in cancer, arthritis, and cardiovascular disease.Becker D.P., Barta T.E., Bedell L.J., Boehm T.L., Bond B.R., Carroll J., Carron C.P., Decrescenzo G.A., Easton A.M., Freskos J.N., Funckes-Shippy C.L., Heron M., Hockerman S., Howard C.P., Kiefer J.R., Li M.H., Mathis K.J., McDonald J.J., Mehta P.P., Munie G.E., Sunyer T., Swearingen C.A., Villamil C.I., Welsch D., Williams J.M., Yu Y., Yao J.J. Med. Chem. 53:6653-6680(2010) Simple pseudo-dipeptides with a P2' glutamate a novel inhibitor family of matrix metalloproteases and other metzincins.Devel L., Beau F., Amoura M., Vera L., Cassar-Lajeunesse E., Garcia S., Czarny B., Stura E.A., Dive V.J. Biol. Chem. 287:26647-26656(2012) Hydantoin based inhibitors of MMP13--discovery of AZD6605.De Savi C., Waterson D., Pape A., Lamont S., Hadley E., Mills M., Page K.M., Bowyer J., Maciewicz R.A.Bioorg. Med. Chem. Lett. 23:4705-4712(2013) Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain.Stura E.A., Visse R., Cuniasse P., Dive V., Nagase H.FASEB J. 27:4395-4405(2013) MMP13 mutation causes spondyloepimetaphyseal dysplasia, Missouri type (SEMD(MO) .Kennedy A.M., Inada M., Krane S.M., Christie P.T., Harding B., Lopez-Otin C., Sanchez L.M., Pannett A.A.J., Dearlove A., Hartley C., Byrne M.H., Reed A.A.C., Nesbit M.A., Whyte M.P., Thakker R.V.J. Clin. Invest. 115:2832-2842(2005) Mutations in MMP9 and MMP13 determine the mode of inheritance and the clinical spectrum of metaphyseal anadysplasia.Lausch E., Keppler R., Hilbert K., Cormier-Daire V., Nikkel S., Nishimura G., Unger S., Spranger J., Superti-Furga A., Zabel B.Am. J. Hum. Genet. 85:168-178(2009) +Additional computationally mapped references.<p>Provides general information on the entry.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58.3 kDa
NCBI Official Full Name
collagenase 3 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 13
NCBI Official Symbol
MMP13
NCBI Official Synonym Symbols
CLG3; MANDP1; MMP-13
NCBI Protein Information
collagenase 3
UniProt Protein Name
Collagenase 3
UniProt Gene Name
MMP13
UniProt Synonym Gene Names
MMP-13
UniProt Entry Name
MMP13_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The MMP13 mmp13 (Catalog #AAA114036) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 104-471. Full Length of Mature Protein. The amino acid sequence is listed below: YNVFPRTLKW SKMNLTYRIV NYTPDMTHSE VEKAFKKAFK VWSDVTPLNF TRLHDGIADI MISFGIKEHG DFYPFDGPSG LLAHAFPPGP NYGGDAHFDD DETWTSSSKG YNLFLVAAHE FGHSLGLDHS KDPGALMFPI YTYTGKSHFM LPDDDVQGIQ SLYGPGDEDP NPKHPKTPDK CDPSLSLDAI TSLRGETMIF KDRFFWRLHP QQVDAELFLT KSFWPELPNR IDAAYEHPSH DLIFIFRGRK FWALNGYDIL EGYPKKISEL GLPKEVKKIS AAVHFEDTGK TLLFSGNQVW RYDDTNHIMD KDYPRLIEED FPGIGDKVDA VYEKNGYIYF FNGPIQFEYS IWSNRIVRVM PANSILWC. It is sometimes possible for the material contained within the vial of "Collagenase 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
