Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mammalian Cell TACSTD2 Active Protein – Cat# AAA243733 – Bioactivity Bioactivity

Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Mammalian Cell Active Protein

Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2), Partial (Active)

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor-Associated Calcium Signal Transducer 2 (TACSTD2); N/A; Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2), Partial (Active); Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1; GA733-1; M1S1; TROP2; TACSTD2 active protein
Ordering

Product Overview

Host
Mammalian cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
27-274aa; Partial
Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Sequence Length
323
Species
Human
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

Mammalian Cell TACSTD2 Active Protein – Cat# AAA243733 – Bioactivity Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Mammalian Cell TACSTD2 Active Protein – Cat# AAA243733 – SDS-PAGE SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Product Categories/Family for TACSTD2 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56.8 kDa
NCBI Official Full Name
tumor-associated calcium signal transducer 2
UniProt Protein Name
Tumor-associated calcium signal transducer 2
UniProt Gene Name
TACSTD2
UniProt Synonym Gene Names
GA733-1; M1S1; TROP2
UniProt Entry Name
TACD2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TACSTD2 tacstd2 (Catalog #AAA243733) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-274aa; Partial. The amino acid sequence is listed below: HTAAQDNCTC PTNKMTVCSP DGPGGRCQCR ALGSGMAVDC STLTSKCLLL KARMSAPKNA RTLVRPSEHA LVDNDGLYDP DCDPEGRFKA RQCNQTSVCW CVNSVGVRRT DKGDLSLRCD ELVRTHHILI DLRHRPTAGA FNHSDLDAEL RRLFRERYRL HPKFVAAVHY EQPTIQIELR QNTSQKAAGD VDIGDAAYYF ERDIKGESLF QGRGGLDLRV RGEPLQVERT LIYYLDEIPP KFSMKRLT. It is sometimes possible for the material contained within the vial of "Tumor-Associated Calcium Signal Transducer 2 (TACSTD2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.