Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mammalian Cell EFNA5 Active Protein – Cat# AAA243728 – Bioactivity Bioactivity

Ephrin-A5 (EFNA5) Mammalian Cell Active Protein

Recombinant Human Ephrin-A5 (EFNA5) (Active)

Average rating 0.0
No ratings yet
Gene Names
EFNA5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ephrin-A5 (EFNA5); N/A; Recombinant Human Ephrin-A5 (EFNA5) (Active); AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5 active protein
Ordering

Product Overview

Host
Mammalian cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4.
Sequence Positions
21-203aa; Full Length of Mature Protein
Sequence
QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Sequence Length
228
Species
Human
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized EPHA3 (MBS956024) at 2 ug/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

Mammalian Cell EFNA5 Active Protein – Cat# AAA243728 – Bioactivity Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Mammalian Cell EFNA5 Active Protein – Cat# AAA243728 – SDS-PAGE SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for EFNA5 active protein
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
Product Categories/Family for EFNA5 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.1 kDa
NCBI Official Full Name
ephrin-A5
NCBI Official Synonym Full Names
ephrin A5
NCBI Official Symbol
EFNA5
NCBI Official Synonym Symbols
AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
NCBI Protein Information
ephrin-A5
UniProt Protein Name
Ephrin-A5
UniProt Gene Name
EFNA5
UniProt Synonym Gene Names
EPLG7; LERK7; LERK-7
UniProt Entry Name
EFNA5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The EFNA5 efna5 (Catalog #AAA243728) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-203aa; Full Length of Mature Protein. The amino acid sequence is listed below: QDPGSKAVAD RYAVYWNSSN PRFQRGDYHI DVCINDYLDV FCPHYEDSVP EDKTERYVLY MVNFDGYSAC DHTSKGFKRW ECNRPHSPNG PLKFSEKFQL FTPFSLGFEF RPGREYFYIS SAIPDNGRRS CLKLKVFVRP TNSCMKTIGV HDRVFDVNDK VENSLEPADD TVHESAEPSR GEN. It is sometimes possible for the material contained within the vial of "Ephrin-A5 (EFNA5), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.