Lutropin Subunit Beta (LHB) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Bovine Lutropin subunit beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lutropin subunit beta; N/A; Recombinant Bovine Lutropin subunit beta; Luteinizing hormone subunit beta; LH-B; LSH-B; LSH-beta; Lutropin beta chain; LHB recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-141aa; Full Length
Sequence
SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Sequence Length
141
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for LHB recombinant protein
Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
References
The gene for the beta subunit of bovine luteinizing hormone encodes a gonadotropin mRNA with an unusually short 5'-untranslated region.Virgin J.B., Silver B.J., Thomason A.R., Nilson J.H.J. Biol. Chem. 260:7072-7077(1985) Analysis of several bovine lutropin beta subunit cDNAs reveals heterogeneity in nucleotide sequence.Maurer R.A.J. Biol. Chem. 260:4684-4687(1985) Luteinizing hormone. The primary structures of the beta-subunit from bovine and porcine species.Maghuin-Rogister G., Hennen G.Eur. J. Biochem. 39:235-253(1973)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
lutropin subunit beta
NCBI Official Symbol
LHB
NCBI Protein Information
lutropin subunit beta
UniProt Protein Name
Lutropin subunit beta
UniProt Gene Name
LHB
UniProt Synonym Gene Names
LH-B; LSH-B; LSH-beta
UniProt Entry Name
LSHB_BOVIN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The LHB lhb (Catalog #AAA113871) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-141aa; Full Length. The amino acid sequence is listed below: SRGPLRPLCQ PINATLAAEK EACPVCITFT TSICAGYCPS MKRVLPVILP PMPQRVCTYH ELRFASVRLP GCPPGVDPMV SFPVALSCHC GPCRLSSTDC GGPRTQPLAC DHPPLPDILF L. It is sometimes possible for the material contained within the vial of "Lutropin subunit beta, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
