Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell LGALS9 Recombinant Protein – Cat# AAA115243 – SDS-PAGE SDS-PAGE

Galectin-9 Isoform Short (LGALS9) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human Galectin-9

Average rating 0.0
No ratings yet
Gene Names
LGALS9; HUAT; LGALS9A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Galectin-9; N/A; Recombinant Human Galectin-9; Ecalectin; Tumor antigen HOM-HD-21; LGALS9 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-323aa; Full length of Isoform 2
Sequence
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Sequence Length
323
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell LGALS9 Recombinant Protein – Cat# AAA115243 – SDS-PAGE SDS-PAGE
Related Product Information for LGALS9 recombinant protein
Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil choattractant.
Product Categories/Family for LGALS9 recombinant protein
References
Molecular definition of a novel human galectin which is immunogenic in patients with Hodgkin's disease.Tuereci O., Schmitt H., Fadle N., Pfreundschuh M., Sahin U.J. Biol. Chem. 272:6416-6422(1997) Human galectin-9 isoform full-length cDNA from gastric adenocarcinoma.Kato S. Human ecalectin, a variant of human galectin-9, is a novel eosinophil chemoattractant produced by T lymphocytes.Matsumoto R., Matsumoto H., Seki M., Hata M., Asano Y., Kanegasaki S., Stevens R.L., Hirashima M.J. Biol. Chem. 273:16976-16984(1998) Cloning and expression of human urate transporter mRNA.Nakajima H., Shichiri M., Hamaguchi T. Homo sapiens galectin-9 (LGALS9) / ecalectin gene, exon 2 through 11.Akiyama S.Genomic organization of the human galectin-9 gene.Graessler J., Spitzenberger F., Schroeder H.E.Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.7 kDa
NCBI Official Full Name
galectin-9 isoform short
NCBI Official Synonym Full Names
lectin, galactoside-binding, soluble, 9
NCBI Official Symbol
LGALS9
NCBI Official Synonym Symbols
HUAT; LGALS9A
NCBI Protein Information
galectin-9
UniProt Protein Name
Galectin-9
UniProt Gene Name
LGALS9
UniProt Synonym Gene Names
Gal-9
UniProt Entry Name
LEG9_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The LGALS9 lgals9 (Catalog #AAA115243) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-323aa; Full length of Isoform 2. The amino acid sequence is listed below: MAFSGSQAPY LSPAVPFSGT IQGGLQDGLQ ITVNGTVLSS SGTRFAVNFQ TGFSGNDIAF HFNPRFEDGG YVVCNTRQNG SWGPEERKTH MPFQKGMPFD LCFLVQSSDF KVMVNGILFV QYFHRVPFHR VDTISVNGSV QLSYISFQPP GVWPANPAPI TQTVIHTVQS APGQMFSTPA IPPMMYPHPA YPMPFITTIL GGLYPSKSIL LSGTVLPSAQ RFHINLCSGN HIAFHLNPRF DENAVVRNTQ IDNSWGSEER SLPRKMPFVR GQSFSVWILC EAHCLKVAVD GQHLFEYYHR LRNLPTINRL EVGGDIQLTH VQT. It is sometimes possible for the material contained within the vial of "Galectin-9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.