Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell LDHA Recombinant Protein – Cat# AAA27011 – SDS-PAGE SDS-PAGE

L-Lactate Dehydrogenase A Chain Isoform 2 (LDHA) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial

Average rating 0.0
No ratings yet
Gene Names
LDHA; LDHM; GSD11; PIG19; HEL-S-133P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-lactate dehydrogenase A chain (LDHA); N/A; Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDHA recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
5-323aa; partial
Sequence
KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Organism
Homo sapiens (Human)
Tag Information
NO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell LDHA Recombinant Protein – Cat# AAA27011 – SDS-PAGE SDS-PAGE
Product Categories/Family for LDHA recombinant protein
References
"Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification." Maekawa M., Sudo K., Li S.S., Kanno T.Hum. Genet. 88:34-38 (1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.1 kDa
NCBI Official Full Name
L-lactate dehydrogenase A chain isoform 2
NCBI Official Synonym Full Names
lactate dehydrogenase A
NCBI Official Symbol
LDHA
NCBI Official Synonym Symbols
LDHM; GSD11; PIG19; HEL-S-133P
NCBI Protein Information
L-lactate dehydrogenase A chain
UniProt Protein Name
L-lactate dehydrogenase A chain
UniProt Gene Name
LDHA
UniProt Synonym Gene Names
LDH-A; LDH-M

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The LDHA ldha (Catalog #AAA27011) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 5-323aa; partial with tag NO-tagged. The amino acid sequence is listed below: KDQLIYNLLK EEQTPQNKIT VVGVGAVGMA CAISILMKDL ADELALVDVI EDKLKGEMMD LQHGSLFLRT PKIVSGKDYN VTANSKLVII TAGARQQEGE SRLNLVQRNV NIFKFIIPNV VKYSPNCKLL IVSNPVDILT YVAWKISGFP KNRVIGSGCN LDSARFRYLM GERLGVHPLS CHGWVLGEHG DSSVPVWSGM NVAGVSLKTL HPDLGTDKDK EQWKEVHKQV VESAYEVIKL KGYTSWAIGL SVADLAESIM KNLRRVHPVS TMIKGLYGIK DDVFLSVPCI LGQNGISDLV KVTLTSEEEA RLKKSADTL . It is sometimes possible for the material contained within the vial of "L-lactate dehydrogenase A chain (LDHA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.