Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell KRT7 Recombinant Protein – Cat# AAA113130 – SDS-PAGE SDS-PAGE

Keratin, Type II Cytoskeletal 7 (KRT7) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human Keratin, type II cytoskeletal 7 (KRT7)

Average rating 0.0
No ratings yet
Gene Names
KRT7; K7; CK7; SCL; K2C7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratin, type II cytoskeletal 7 (KRT7); N/A; Recombinant Human Keratin, type II cytoskeletal 7 (KRT7); Keratin, type II cytoskeletal 7; Cytokeratin-7; CK-7; Keratin-7; K7; Sarcolectin; Type-II keratin Kb7; KRT7 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-469aa; Full Length of Mature Protein
Sequence
SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell KRT7 Recombinant Protein – Cat# AAA113130 – SDS-PAGE SDS-PAGE
Related Product Information for KRT7 recombinant protein
Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Product Categories/Family for KRT7 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67.3 kDa
NCBI Official Full Name
keratin, type II cytoskeletal 7
NCBI Official Synonym Full Names
keratin 7
NCBI Official Symbol
KRT7
NCBI Official Synonym Symbols
K7; CK7; SCL; K2C7
NCBI Protein Information
keratin, type II cytoskeletal 7; CK-7; keratin-7; sarcolectin; cytokeratin 7; cytokeratin-7; type-II keratin Kb7; type II mesothelial keratin K7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7
UniProt Protein Name
Keratin, type II cytoskeletal 7
UniProt Gene Name
KRT7
UniProt Synonym Gene Names
SCL; CK-7; K7
UniProt Entry Name
K2C7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The KRT7 krt7 (Catalog #AAA113130) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-469aa; Full Length of Mature Protein. The amino acid sequence is listed below: SIHFSSPVFT SRSAAFSGRG AQVRLSSARP GGLGSSSLYG LGASRPRVAV RSAYGGPVGA GIREVTINQS LLAPLRLDAD PSLQRVRQEE SEQIKTLNNK FASFIDKVRF LEQQNKLLET KWTLLQEQKS AKSSRLPDIF EAQIAGLRGQ LEALQVDGGR LEAELRSMQD VVEDFKNKYE DEINHRTAAE NEFVVLKKDV DAAYMSKVEL EAKVDALNDE INFLRTLNET ELTELQSQIS DTSVVLSMDN SRSLDLDGII AEVKAQYEEM AKCSRAEAEA WYQTKFETLQ AQAGKHGDDL RNTRNEISEM NRAIQRLQAE IDNIKNQRAK LEAAIAEAEE RGELALKDAR AKQEELEAAL QRGKQDMARQ LREYQELMSV KLALDIEIAT YRKLLEGEES RLAGDGVGAV NISVMNSTGG SSSGGGIGLT LGGTMGSNAL SFSSSAGPGL LKAYSIRTAS ASRRSARD. It is sometimes possible for the material contained within the vial of "Keratin, type II cytoskeletal 7 (KRT7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.