Killer Cell Immunoglobulin-Like Receptor 2DS1 (KIR2DS1) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Killer cell immunoglobulin-like receptor 2DS1
Gene Names
KIR2DS1; p50.1; CD158H; CD158a; KIR2DS4; KIR2DP1DL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Killer cell immunoglobulin-like receptor 2DS1; N/A; Recombinant Human Killer cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member HMHC class I NK cell receptor Eb6 ActI; CD158h; KIR2DS1 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-245aa; Extracellular Domain
Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for KIR2DS1 recombinant protein
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Product Categories/Family for KIR2DS1 recombinant protein
References
The human leukocyte antigen (HLA)-C-specific 'activatory' or 'inhibitory' natural killer cell receptors display highly homologous extracellular domains but differ in their transmembrane and intracytoplasmic portions.Biassoni R., Cantoni C., Falco M., Verdiani S., Bottino C., Vitale M., Conte R., Poggi A., Moretta A., Moretta L.J. Exp. Med. 183:645-650(1996) Human diversity in killer cell inhibitory receptor genes.Uhrberg M., Valiante N.M., Shum B.P., Shilling H.G., Lienert-Weidenbach K., Corliss B., Tyan D., Lanier L.L., Parham P.Immunity 7:753-763(1997) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.8 kDa
NCBI Official Full Name
killer cell immunoglobulin-like receptor 2DS1
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
NCBI Official Symbol
KIR2DS1
NCBI Official Synonym Symbols
p50.1; CD158H; CD158a; KIR2DS4; KIR2DP1DL1
NCBI Protein Information
killer cell immunoglobulin-like receptor 2DS1
UniProt Protein Name
Killer cell immunoglobulin-like receptor 2DS1
UniProt Gene Name
KIR2DS1
UniProt Synonym Gene Names
CD158H
UniProt Entry Name
KI2S1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The KIR2DS1 kir2ds1 (Catalog #AAA117115) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-245aa; Extracellular Domain. The amino acid sequence is listed below: HEGVHRKPSL LAHPGRLVKS EETVILQCWS DVMFEHFLLH REGMFNDTLR LIGEHHDGVS KANFSISRMR QDLAGTYRCY GSVTHSPYQL SAPSDPLDIV IIGLYEKPSL SAQPGPTVLA GENVTLSCSS RSSYDMYHLS REGEAHERRL PAGTKVNGTF QANFPLGPAT HGGTYRCFGS FRDSPYEWSK SSDPLLVSVT GNPSNSWPSP TEPSSETGNP RHLH. It is sometimes possible for the material contained within the vial of "Killer cell immunoglobulin-like receptor 2DS1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
