Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell isdA Recombinant Protein – Cat# AAA18786 – SDS-PAGE SDS-PAGE

MULTISPECIES: Iron-Regulated Surface Determinant Protein A (isdA) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA)

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Iron-regulated surface determinant protein A (isdA); N/A; Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA); isdA recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
47-316aa; Full Length of Mature Protein
Sequence
ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT
Species
Staphylococcus aureus (strain MSSA476)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell isdA Recombinant Protein – Cat# AAA18786 – SDS-PAGE SDS-PAGE
Related Product Information for isdA recombinant protein
Transfers its hemin to hemin-free IsdC (apo-IsdC) directly probably through the activated holo-IsdA-apo-IsdC complex and driven by the higher affinity of apo-IsdC for the cofactor. The reaction is reversible. Binds transferrin, lactoferrin, heme, hemoglobin, hemin, fetuin, asialofetuin and protein A. Also binds fibronectin and chains B-beta and gamma of fibrinogen. Could play a role in the removal of heme from hemoglobin. The IsdA-mediated iron-acquisition system from transferrin could play only an ancillary role in the iron uptake whereas the siderophore-mediated iron-acquisition system from transferrin seems to play an essential or dominant role. May function as a reservoir for heme. Involved in adherence of S.aureus to human desquamated nasal epithelial cells and is required for nasal colonization. Protects S.aureus against the bactericidal protease activity of apolactoferrin in vitro and confers resistance to bovine lactoferricin. Also IsdA and
or IsdB promote resistance to hydrogen peroxide and killing by neutrophils
References
"Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C.Parkhill J. Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.1 kDa
NCBI Official Full Name
MULTISPECIES: iron-regulated surface determinant protein A
UniProt Protein Name
Iron-regulated surface determinant protein A
UniProt Gene Name
isdA
UniProt Synonym Gene Names
frpA; stbA

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The isdA isda (Catalog #AAA18786) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 47-316aa; Full Length of Mature Protein. The amino acid sequence is listed below: ATEATNATNN QSTQVSQATS QPINFQVQKD GSSEKSHMDD YMQHPGKVIK QNNKYYFQTV LNNASFWKEY KFYNANNQEL ATTVVNDNKK ADTRTINVAV EPGYKSLTTK VHIVVPQINY NHRYTTHLEF EKAIPTLADA AKPNNVKPVQ PKPAQPKTPT EQTKPVQPKV EKVKPTVTTT SKVEDNHSTK VVSTDTTKDQ TKTQTAHTVK TAQTAQEQNK VQTPVKDVAT AKSESNNQAV SDNKSQQTNK VTKHNETPKQ ASKAKELPKT . It is sometimes possible for the material contained within the vial of "Iron-regulated surface determinant protein A (isdA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.