Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell IDUA Recombinant Protein – Cat# AAA15934 – SDS-PAGE SDS-PAGE

Alpha-L-Iduronidase (IDUA) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human Alpha-L-iduronidase (IDUA)

Average rating 0.0
No ratings yet
Gene Names
IDUA; IDA; MPS1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-L-iduronidase (IDUA); N/A; Recombinant Human Alpha-L-iduronidase (IDUA); IDUA recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-653aa; Full Length of Mature Protein
Sequence
APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell IDUA Recombinant Protein – Cat# AAA15934 – SDS-PAGE SDS-PAGE
Product Categories/Family for IDUA recombinant protein
References
Human alpha-L-iduronidase cDNA isolation and expression.Scott H.S., Anson D.S., Orsborn A.M., Nelson P.V., Clements P.R., Morris C.P., Hopwood J.J.Proc. Natl. Acad. Sci. U.S.A. 88:9695-9699(1991) Structure and sequence of the human alpha-L-iduronidase gene.Scott H.S., Guo X.H., Hopwood J.J., Morris C.P.Genomics 13:1311-1313(1992) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Molecular genetics of mucopolysaccharidosis type I diagnostic, clinical, and biological implications.Scott H.S., Bunge S., Gal A., Clarke L.A., Morris C.P., Hopwood J.J.Hum. Mutat. 6:288-302(1995) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.Bie H., Yin J., He X., Kermode A.R., Goddard-Borger E.D., Withers S.G., James M.N.Nat. Chem. Biol. 9:739-745(2013) Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module.Maita N., Tsukimura T., Taniguchi T., Saito S., Ohno K., Taniguchi H., Sakuraba H.Proc. Natl. Acad. Sci. U.S.A. 110:14628-14633(2013) Mutation analysis of 19 North American mucopolysaccharidosis type I patients identification of two additional frequent mutations.Clarke L.A., Nelson P.V., Warrington C.L., Morris C.P., Hopwood J.J., Scott H.S.Hum. Mutat. 3:275-282(1994) Two novel mutations causing mucopolysaccharidosis type I detected by single strand conformational analysis of the alpha-L-iduronidase gene.Clark L.A., Scott H.S.Hum. Mol. Genet. 2:1311-1312(1993) Identification of mutations in the alpha-L-iduronidase gene (IDUA) that cause Hurler and Scheie syndromes.Scott H.S., Litjens T., Nelson P.V., Thompson P.R., Brooks D.A., Hopwood J.J., Morris C.P.Am. J. Hum. Genet. 53:973-986(1993) Molecular analysis of Hurler syndrome in Druze and Muslim Arab patients in Israel multiple allelic mutations of the IDUA gene in a small geographic area.Bach G., Moskowitz S.M., Tieu P.T., Matynia A., Neufeld E.F.Am. J. Hum. Genet. 53:330-338(1993) Alpha-L-iduronidase mutations (Q70X and P533R) associate with a severe Hurler phenotype.Scott H.S., Litjens T., Nelson P.V., Brooks D.A., Hopwood J.J., Morris C.P.Hum. Mutat. 1:333-339(1992) Mucopolysaccharidosis type I identification of 8 novel mutations and determination of the frequency of the two common alpha-L-iduronidase mutations (W402X and Q70X) among European patients.Bunge S., Kleijer W.J., Steglich C., Beck M., Zuther C., Morris C.P., Schwinger E., Hopwood J.J., Scott H.S., Gal A.Hum. Mol. Genet. 3:861-866(1994) PCR detection of two RFLPs in exon I of the alpha-L-iduronidase (IDUA) gene.Scott H.S., Litjens T., Hopwood J.J., Morris C.P.Hum. Genet. 90:327-327(1992) Multiple polymorphisms within the alpha-L-iduronidase gene (IDUA) implications for a role in modification of MPS-I disease phenotype.Scott H.S., Nelson P.V., Litjens T., Hopwood J.J., Morris C.P.Hum. Mol. Genet. 2:1471-1473(1993) Four novel mutations underlying mild or intermediate forms of alpha-L-iduronidase deficiency (MPS IS and MPS IH/S) .Tieu P.T., Bach G., Matynia A., Hwang M., Neufeld E.F.Hum. Mutat. 6:55-59(1995) Mucopolysaccharidosis type I identification of 13 novel mutations of the alpha-L-iduronidase gene.Bunge S., Kleijer W.J., Steglich C., Beck M., Schwinger E., Gal A.Hum. Mutat. 6:91-94(1995) Molecular genetic defect underlying alpha-L-iduronidase pseudodeficiency.Aronovich E.L., Pan D., Whitley C.B.Am. J. Hum. Genet. 58:75-85(1996) A novel missense mutation in the human IDUA gene associated with a severe Hurler's phenotype.Bartholomew D.W., McClellan J.M.Hum. Mutat. 12:291-291(1998) Mucopolysaccharidosis type I characterization of novel mutations affecting alpha-L-iduronidase activity.Lee-Chen G.J., Lin S.P., Tang Y.F., Chin Y.W.Clin. Genet. 56:66-70(1999) Identification and characterization of -3c-g acceptor splice site mutation in human alpha-L-iduronidase associated with mucopolysaccharidosis type IH/S.Teng Y.N., Wang T.R., Hwu W.L., Lin S.P., Lee-Chen G.J.Clin. Genet. 57:131-136(2000) Identification and characterization of 13 new mutations in mucopolysaccharidosis type I patients.Matte U., Yogalingam G., Brooks D., Leistner S., Schwartz I., Lima L., Norato D.Y., Brum J.M., Beesley C., Winchester B., Giugliani R., Hopwood J.J.Mol. Genet. Metab. 78:37-43(2003) Identification and molecular characterization of alpha-L-iduronidase mutations present in mucopolysaccharidosis type I patients undergoing enzyme replacement therapy.Yogalingam G., Guo X.H., Muller V.J., Brooks D.A., Clements P.R., Kakkis E.D., Hopwood J.J.Hum. Mutat. 24:199-207(2004) Mucopolysaccharidosis type I in 21 Czech and Slovak patients mutation analysis suggests a functional importance of C-terminus of the IDUA protein.Vazna A., Beesley C., Berna L., Stolnaja L., Myskova H., Bouckova M., Vlaskova H., Poupetova H., Zeman J., Magner M., Hlavata A., Winchester B., Hrebicek M., Dvorakova L.Am. J. Med. Genet. A 149A:965-974(2009) IDUA mutational profiling of a cohort of 102 European patients with mucopolysaccharidosis type I identification and characterization of 35 novel alpha-L-iduronidase (IDUA) alleles.Bertola F., Filocamo M., Casati G., Mort M., Rosano C., Tylki-Szymanska A., Tuysuz B., Gabrielli O., Grossi S., Scarpa M., Parenti G., Antuzzi D., Dalmau J., Di Rocco M., Vici C.D., Okur I., Rosell J., Rovelli A., Furlan F., Rigoldi M., Biondi A., Cooper D.N., Parini R.Hum. Mutat. 32:E2189-E2210(2011) p.L18P a novel IDUA mutation that causes a distinct attenuated phenotype in mucopolysaccharidosis type I patients.Pasqualim G., Ribeiro M.G., da Fonseca G.G., Szlago M., Schenone A., Lemes A., Rojas M.V., Matte U., Giugliani R.Clin. Genet. 0:0-0(2014) +Additional computationally mapped references.<p>Provides general information on the entry.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71.9 kDa
NCBI Official Full Name
alpha-L-iduronidase
NCBI Official Synonym Full Names
iduronidase, alpha-L-
NCBI Official Symbol
IDUA
NCBI Official Synonym Symbols
IDA; MPS1
NCBI Protein Information
alpha-L-iduronidase
UniProt Protein Name
Alpha-L-iduronidase
UniProt Gene Name
IDUA
UniProt Entry Name
IDUA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The IDUA idua (Catalog #AAA15934) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-653aa; Full Length of Mature Protein. The amino acid sequence is listed below: APHLVHVDAA RALWPLRRFW RSTGFCPPLP HSQADQYVLS WDQQLNLAYV GAVPHRGIKQ VRTHWLLELV TTRGSTGRGL SYNFTHLDGY LDLLRENQLL PGFELMGSAS GHFTDFEDKQ QVFEWKDLVS SLARRYIGRY GLAHVSKWNF ETWNEPDHHD FDNVSMTMQG FLNYYDACSE GLRAASPALR LGGPGDSFHT PPRSPLSWGL LRHCHDGTNF FTGEAGVRLD YISLHRKGAR SSISILEQEK VVAQQIRQLF PKFADTPIYN DEADPLVGWS LPQPWRADVT YAAMVVKVIA QHQNLLLANT TSAFPYALLS NDNAFLSYHP HPFAQRTLTA RFQVNNTRPP HVQLLRKPVL TAMGLLALLD EEQLWAEVSQ AGTVLDSNHT VGVLASAHRP QGPADAWRAA VLIYASDDTR AHPNRSVAVT LRLRGVPPGP GLVYVTRYLD NGLCSPDGEW RRLGRPVFPT AEQFRRMRAA EDPVAAAPRP LPAGGRLTLR PALRLPSLLL VHVCARPEKP PGQVTRLRAL PLTQGQLVLV WSDEHVGSKC LWTYEIQFSQ DGKAYTPVSR KPSTFNLFVF SPDTGAVSGS YRVRALDYWA RPGPFSDPVP YLEVPVPRGP PSPGNP . It is sometimes possible for the material contained within the vial of "Alpha-L-iduronidase (IDUA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.