Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell Icos Recombinant Protein – Cat# AAA117639 – SDS-PAGE SDS-PAGE

Inducible T-Cell Costimulator (Icos) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Rat Inducible T-cell costimulator (Icos)

Average rating 0.0
No ratings yet
Gene Names
Icos; Ailim
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inducible T-cell costimulator (Icos); N/A; Recombinant Rat Inducible T-cell costimulator (Icos); Inducible T-cell costimulator; Activation-inducible lymphocyte immunomediatory molecule; CD_antigen=; CD278; Icos recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-145aa; Extracellular Domain
Sequence
ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP
Sequence Length
125
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell Icos Recombinant Protein – Cat# AAA117639 – SDS-PAGE SDS-PAGE
Related Product Information for Icos recombinant protein
Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity).
Product Categories/Family for Icos recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.1 kDa
NCBI Official Full Name
inducible T-cell costimulator
NCBI Official Synonym Full Names
inducible T-cell co-stimulator
NCBI Official Symbol
Icos
NCBI Official Synonym Symbols
Ailim
NCBI Protein Information
inducible T-cell costimulator; activation-inducible lymphocyte immunomediatory molecule
UniProt Protein Name
Inducible T-cell costimulator
UniProt Gene Name
Icos
UniProt Synonym Gene Names
Ailim
UniProt Entry Name
ICOS_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The Icos icos (Catalog #AAA117639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-145aa; Extracellular Domain. The amino acid sequence is listed below: ELNDLANHRM FSFHDGGVQI SCNYPETVQQ LKMQLFKDRE VLCDLTKTKG SGNTVSIKNP MSCPYQLSNN SVSFFLDNAD SSQGSYFLCS LSIFDPPPFQ EKNLSGGYLL IYESQLCCQL KLWLP. It is sometimes possible for the material contained within the vial of "Inducible T-cell costimulator (Icos), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.