HLA Class II Histocompatibility Antigen, DRB1-1 Beta Chain (HLA-DRB1) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human HLA class II histocompatibility antigen, DRB1-1 beta chain (HLA-DRB1)
Gene Names
HLA-DRB1; SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA class II histocompatibility antigen, DRB1-1 beta chain (HLA-DRB1); N/A; Recombinant Human HLA class II histocompatibility antigen, DRB1-1 beta chain (HLA-DRB1); HLA class II histocompatibility antigen, DRB1-1 beta chain; MHC class II antigen DRB1*1; DR-1; DR1; HLA-DRB1 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-227aa; Extracellular Domain
Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK
Sequence Length
227
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HLA-DRB1 recombinant protein
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route; where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules; and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments; exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides; autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs; other cells of the gastrointestinal tract; such as epithelial cells; express MHC class II molecules and CD74 and act as APCs; which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen; three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs; CD74 undergoes a sequential degradation by various proteases; including CTSS and CTSL; leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells; the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules; increased acidification produces increased proteolysis and efficient peptide loading.
(Microbial infection) Acts as a receptor for Epstein-Barr virus on lymphocytes.
(Microbial infection) Acts as a receptor for Epstein-Barr virus on lymphocytes.
Product Categories/Family for HLA-DRB1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42.9 kDa
NCBI Official Full Name
HLA class II histocompatibility antigen, DRB1-1 beta chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DR beta 1
NCBI Official Symbol
HLA-DRB1
NCBI Official Synonym Symbols
SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B
NCBI Protein Information
major histocompatibility complex, class II, DR beta 1; DW2.2/DR2.2; MHC class II antigen; lymphocyte antigen DRB1; MHC class II HLA-DRw10-beta; human leucocyte antigen DRB1; MHC class II HLA-DR beta 1 chain; MHC class II HLA-DR-beta cell surface glycoprotein; HLA class II histocompatibility antigen, DR-1 beta chain
UniProt Protein Name
HLA class II histocompatibility antigen, DRB1-1 beta chain
UniProt Gene Name
HLA-DRB1
UniProt Synonym Gene Names
DR-1; DR1
UniProt Entry Name
2B11_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The HLA-DRB1 hla-drb1 (Catalog #AAA114968) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-227aa; Extracellular Domain. The amino acid sequence is listed below: GDTRPRFLWQ LKFECHFFNG TERVRLLERC IYNQEESVRF DSDVGEYRAV TELGRPDAEY WNSQKDLLEQ RRAAVDTYCR HNYGVGESFT VQRRVEPKVT VYPSKTQPLQ HHNLLVCSVS GFYPGSIEVR WFRNGQEEKA GVVSTGLIQN GDWTFQTLVM LETVPRSGEV YTCQVEHPSV TSPLTVEWRA RSESAQSK. It is sometimes possible for the material contained within the vial of "HLA class II histocompatibility antigen, DRB1-1 beta chain (HLA-DRB1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
