Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli HLA-C Recombinant Protein – Cat# AAA116185 – SDS-PAGE SDS-PAGE

MHC Class I Antigen (HLA-C Protein) (HLA-C) E Coli Recombinant Protein

Recombinant Human HLA-C protein

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA-C; N/A; Recombinant Human HLA-C protein; HLA-C recombinant protein
Ordering

Product Overview

Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-308aa; Partial
Sequence
CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI
Sequence Length
308
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli HLA-C Recombinant Protein – Cat# AAA116185 – SDS-PAGE SDS-PAGE
Related Product Information for HLA-C recombinant protein
Involved in the presentation of foreign antigens to the immune system. SAAS annotation
Product Categories/Family for HLA-C recombinant protein
References
Zhang L., Hildebrand W.H.Full genomic sequence alignments for HLA-B and -C.Cox S.T. Identification of novel HLA class I alleles by direct sequencing of SSP-PCR products.Robbins F.-M., Adams S., Russ C., Bishop M., Stroncek D.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
36.7 kDa
NCBI Official Full Name
MHC class I antigen (HLA-C protein)
UniProt Protein Name
HLA-C protein
UniProt Gene Name
HLA-C
UniProt Entry Name
O78179_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HLA-C hla-c (Catalog #AAA116185) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-308aa; Partial. The amino acid sequence is listed below: CSHSMRYFYT AVSRPGRGEP RFIAVGYVDD TQFVRFDSDA ASPRGEPRAP WVEQEGPEYW DRETQKYKRQ AQTDRVSLRN LRGYYNQSEA GSHTLQWMYG CDLGPDGRLL RGYDQSAYDG KDYIALNEDL RSWTAADTAA QITQRKWEAA RAAEQQRAYL EGTCVEWLRR YLENGKETLQ RAEHPKTHVT HHLVSDHEAT LRCWALGFYP AEITLTWQRD GEDQTQDTEL VETRPAGDGT FQKWAAVVVP SGEEQRYTCH VQHEGLPEPL TLRWEPSSQP TIPI. It is sometimes possible for the material contained within the vial of "HLA-C, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.