Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18592_SDS_PAGE.jpg SDS-PAGE

Influenza A virus Hemagglutinin Recombinant Protein | HA recombinant protein

Recombinant Influenza A virus Hemagglutinin

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Influenza A virus Hemagglutinin; N/A; Recombinant Influenza A virus Hemagglutinin; Influenza A virus (strain A/Bangkok/1/1979 H3N2); HA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
330-550aa(X347S,X348S,X509S,X538S); partial
Sequence
GIFGAIAGFIENGWEGMSSGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMVSCQKGNIRCNICI
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18592_SDS_PAGE.jpg SDS-PAGE
Related Product Information for HA recombinant protein
Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
Product Categories/Family for HA recombinant protein
References
"Conservation and variation in the hemagglutinins of Hong Kong subtype influenza viruses during antigenic drift." Both G.W., Sleigh M.J. J. Virol. 39:663-672(1981)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
27.3 kDa
NCBI Official Full Name
Hemagglutinin
UniProt Protein Name
Hemagglutinin
UniProt Gene Name
HA
UniProt Entry Name
HEMA_I79A0

Similar Products

Product Notes

The HA ha (Catalog #AAA18592) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 330-550aa(X347S,X348S,X509S,X538S); partial. The amino acid sequence is listed below: GIFGAIAGFI ENGWEGMSSG WYGFRHQNSE GTGQAADLKS TQAAIDQING KLNRVIEKTN EKFHQIEKEF SEVEGRIQDL EKYVEDTKID LWSYNAELLV ALENQHTIDL TDSEMNKLFE KTRRQLRENA EDMGNGCFKI YHKCDNACIG SIRNGTYDHD VYRDEALNNR FQIKGVELKS GYKDWILWIS FAISCFLLCV VLLGFIMVSC QKGNIRCNIC I . It is sometimes possible for the material contained within the vial of "Influenza A virus Hemagglutinin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.