Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18586_SDS_PAGE.jpg SDS-PAGE

Respiratory syncytial virus A Major surface glycoprotein G (G) Recombinant Protein | G recombinant protein

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Respiratory syncytial virus A Major surface glycoprotein G (G); N/A; Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial; Attachment glycoprotein G; Membrane-bound glycoprotein; mG; G recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
67-298aa; Partial
Sequence
HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18586_SDS_PAGE.jpg SDS-PAGE
Related Product Information for G recombinant protein
Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hagglutinating activities. Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors.
References
Nucleotide sequence of the G protein gene of human respiratory syncytial virus reveals an unusual type of viral membrane protein.Wertz G.W., Collins P.L., Huang Y., Gruber C., Levine S., Ball L.A.Proc. Natl. Acad. Sci. U.S.A. 82:4075-4079(1985) A cold-passaged, attenuated strain of human respiratory syncytial virus contains mutations in the F and L genes.Connors M., Crowe J.E. Jr., Firestone C.Y., Murphy B.R., Collins P.L.Virology 208:478-484(1995) The membrane-associated and secreted forms of the respiratory syncytial virus attachment glycoprotein G are synthesized from alternative initiation codons.Roberts S.R., Lichtenstein D., Ball L.A., Wertz G.W.J. Virol. 68:4538-4546(1994) Identification of a linear heparin binding domain for human respiratory syncytial virus attachment glycoprotein G.Feldman S.A., Hendry R.M., Beeler J.A.J. Virol. 73:6610-6617(1999) The fusion glycoprotein of human respiratory syncytial virus facilitates virus attachment and infectivity via an interaction with cellular heparan sulfate.Feldman S.A., Audet S., Beeler J.A.J. Virol. 74:6442-6447(2000) CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein.Tripp R.A., Jones L.P., Haynes L.M., Zheng H., Murphy P.M., Anderson L.J.Nat. Immunol. 2:732-738(2001) The respiratory syncytial virus small hydrophobic protein is phosphorylated via a mitogen-activated protein kinase p38-dependent tyrosine kinase activity during virus infection.Rixon H.W., Brown G., Murray J.T., Sugrue R.J.J. Gen. Virol. 86:375-384(2005) Interaction between the respiratory syncytial virus G glycoprotein cytoplasmic domain and the matrix protein.Ghildyal R., Li D., Peroulis I., Shields B., Bardin P.G., Teng M.N., Collins P.L., Meanger J., Mills J.J. Gen. Virol. 86:1879-1884(2005) The RSV F and G glycoproteins interact to form a complex on the surface of infected cells.Low K.W., Tan T., Ng K., Tan B.H., Sugrue R.J.Biochem. Biophys. Res. Commun. 366:308-313(2008) The secreted form of respiratory syncytial virus G glycoprotein helps the virus evade antibody-mediated restriction of replication by acting as an antigen decoy and through effects on fc receptor-bearing leukocytes.Bukreyev A., Yang L., Fricke J., Cheng L., Ward J.M., Murphy B.R., Collins P.L.J. Virol. 82:12191-12204(2008)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
29.3 kDa
NCBI Official Full Name
Major surface glycoprotein G
UniProt Protein Name
Major surface glycoprotein G
UniProt Gene Name
G
UniProt Synonym Gene Names
mG
UniProt Entry Name
GLYC_HRSVA

Similar Products

Product Notes

The G g (Catalog #AAA18586) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 67-298aa; Partial. The amino acid sequence is listed below: HKVTPTTAII QDATSQIKNT TPTYLTQNPQ LGISPSNPSE ITSQITTILA STTPGVKSTL QSTTVKTKNT TTTQTQPSKP TTKQRQNKPP SKPNNDFHFE VFNFVPCSIC SNNPTCWAIC KRIPNKKPGK KTTTKPTKKP TLKTTKKDPK PQTTKSKEVP TTKPTEEPTI NTTKTNIITT LLTSNTTGNP ELTSQMETFH STSSEGNPSP SQVSTTSEYP SQPSSPPNTP RQ . It is sometimes possible for the material contained within the vial of "Respiratory syncytial virus A Major surface glycoprotein G (G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.