Fc Receptor-Like Protein 6 Isoform 1 (FCRL6) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Fc receptor-like protein 6
Gene Names
FCRL6; FcRH6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fc receptor-like protein 6; N/A; Recombinant Human Fc receptor-like protein 6; Fc receptor homolog 6; FCRL6 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-307aa; Extracellular domain
Sequence
LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Product Categories/Family for FCRL6 recombinant protein
References
"FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection."
Wilson T.J., Presti R.M., Tassi I., Overton E.T., Cella M., Colonna M.
Blood 109:3786-3793(2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33.7 kDa
NCBI Official Full Name
Fc receptor-like protein 6 isoform 1
NCBI Official Synonym Full Names
Fc receptor like 6
NCBI Official Symbol
FCRL6
NCBI Official Synonym Symbols
FcRH6
NCBI Protein Information
Fc receptor-like protein 6
UniProt Protein Name
Fc receptor-like protein 6
UniProt Gene Name
FCRL6
UniProt Synonym Gene Names
FCRH6; FcR-like protein 6; FcRL6; FcRH6
UniProt Entry Name
FCRL6_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The FCRL6 fcrl6 (Catalog #AAA18742) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-307aa; Extracellular domain. The amino acid sequence is listed below: LYLQAWPNPV FEGDALTLRC QGWKNTPLSQ VKFYRDGKFL HFSKENQTLS MGAATVQSRG QYSCSGQVMY IPQTFTQTSE TAMVQVQELF PPPVLSAIPS PEPREGSLVT LRCQTKLHPL RSALRLLFSF HKDGHTLQDR GPHPELCIPG AKEGDSGLYW CEVAPEGGQV QKQSPQLEVR VQAPVSRPVL TLHHGPADPA VGDMVQLLCE AQRGSPPILY SFYLDEKIVG NHSAPCGGTT SLLFPVKSEQ DAGNYSCEAE NSVSRERSEP KKLSLKGSQV LFTPASNW . It is sometimes possible for the material contained within the vial of "Fc receptor-like protein 6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
