Enterotoxin (entA) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Staphylococcus aureus Enterotoxin type A (entA), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Enterotoxin type A (entA); N/A; Recombinant Staphylococcus aureus Enterotoxin type A (entA), partial; SEA; entA recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-253aa; Partial
Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIY
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for entA recombinant protein
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
References
Nucleotide sequence of the type A staphylococcal enterotoxin gene.Betley M.J., Mekalanos J.J.J. Bacteriol. 170:34-41(1988) Complete amino acid sequence of staphylococcal enterotoxin A.Huang I.-Y., Hughes J.L., Bergdoll M.S., Schantz E.J.J. Biol. Chem. 262:7006-7013(1987) Crystal structure of the superantigen staphylococcal enterotoxin type A.Schad E.M., Zaitseva I., Zaitsev V.N., Dohlsten M., Kalland T., Schlievert P.M., Ohlendorf D.H., Svensson L.A.EMBO J. 14:3292-3301(1995) The Co-crystal structure of staphylococcal enterotoxin type A with Zn2+ at 2.7-A resolution. Implications for major histocompatibility complex class II binding.Sundstroem M., Hallen D., Svensson A., Schad E., Dohlsten M., Abrahmsen L.J. Biol. Chem. 271:32212-32216(1996) Residues defining V beta specificity in staphylococcal enterotoxins.Swaminathan S., Furey W.F. Jr., Pletcher J., Sax M.Nat. Struct. Biol. 2:680-686(1995) A structural and functional comparison of staphylococcal enterotoxins A and C2 reveals remarkable similarity and dissimilarity.Schad E.M., Papageorgiou A.C., Svensson L.A., Acharya K.R.J. Mol. Biol. 269:270-280(1997)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30.5 kDa
NCBI Official Full Name
enterotoxin
UniProt Protein Name
Enterotoxin type A
UniProt Gene Name
entA
UniProt Entry Name
ETXA_STAAU
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The entA enta (Catalog #AAA116207) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-253aa; Partial. The amino acid sequence is listed below: SEKSEEINEK DLRKKSELQG TALGNLKQIY YYNEKAKTEN KESHDQFLQH TILFKGFFTD HSWYNDLLVD FDSKDIVDKY KGKKVDLYGA YYGYQCAGGT PNKTACMYGG VTLHDNNRLT EEKKVPINLW LDGKQNTVPL ETVKTNKKNV TVQELDLQAR RYLQEKYNLY NSDVFDGKVQ RGLIVFHTST EPSVNYDLFG AQGQYSNTLL RIYRDNKTIN SENMHIDIY. It is sometimes possible for the material contained within the vial of "Enterotoxin type A (entA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
