Vascular Endothelial Growth Factor A Isoform A (VEGF189) E Coli Active Protein
Human VEGF189
Gene Names
VEGFA; VPF; VEGF; MVCD1
Reactivity
Human
Purity
> 98% by SDS-PAGE & silver stain
Synonyms
VEGF189; N/A; Human VEGF189; Recombinant Human Vascular Endothelial Growth Factor189; VEGF-A; VPF; VEGF189 active protein
Product Overview
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE & silver stain
Form/Format
Lyophilized; 50 mM acetic acid
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Sequence Length
189
Endotoxin Level
< 0.1ng per ug of human VEGF189
Reconstitution
Centrifuge the vial prior to opening! The lyophilized VEGF189 should be reconstituted in water to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Biological Activity
Measured in a cell proliferation assay using primary human umbilical vein endothelial cells (HUVEC) and primary human dermal lymphatic endothelial cells (HDLEC). The ED50 for this effect is typically 2 - 10ng/mL.
Preparation and Storage
Lyophilized samples are stable for greater than 6 months at –20°C to –70°C. Reconstituted VEGF189 should be stored in working aliquots at -20°C.
Related Product Information for VEGF189 active protein
Vascular Endothelial Growth Factor VEGF189, a 21 kDa protein consisting of 189 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR). Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo. VEGF165 is also a chemoattractant molecule for monocytes and endothelial cells. 5 different proteins are generated by differential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homodimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bioavailability is very different. There is good evidence that heterodimeric molecules between the different isoforms also exists and that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF.
Product Categories/Family for VEGF189 active protein
References
1. Breier et al., Dev 114:521, 1992 2. Fiebig et al., Eur J Biochem 211:19, 1993 3. Flamme et al., Dev Biol 162:699, 1995 4. Kremer at al., Cancer Res 57:3852, 1997
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
~40kDa (Dimer, SDS-Page, reduced conditions)
NCBI Official Full Name
vascular endothelial growth factor A isoform a
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The VEGF189 vegfa (Catalog #AAA79232) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human VEGF189 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKKSVRG KGKGQKRRKK SRYKSWSVPC GPCSERRKHL FVQDPQTCKC SCKNTDSRCK ARQLELNERT CRCDKPRR. It is sometimes possible for the material contained within the vial of "VEGF189, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
