Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli CXCL13 Recombinant Protein – Cat# AAA81616 – SDS-PAGE SDS-PAGE

Homo Sapiens Chemokine (C-X-C Motif) Ligand 13 (CXCL13), Mrna (CXCL13) E Coli Recombinant Protein

Recombinant rat C-X-C motif chemokine 13 protein

Average rating 0.0
No ratings yet
Gene Names
CXCL13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
Applications
Western Blot, ELISA, SDS-Page
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 13; N/A; Recombinant rat C-X-C motif chemokine 13 protein; Angie; B cell-attracting chemokine 1; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13; CXCL13 recombinant protein
Ordering

Product Overview

Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS
Applicable Applications for CXCL13 recombinant protein
WB (Western Blot), ELISA, SDS-PAGE
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli CXCL13 Recombinant Protein – Cat# AAA81616 – SDS-PAGE SDS-PAGE
Related Product Information for CXCL13 recombinant protein
Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 KD
NCBI Official Full Name
Homo sapiens chemokine (C-X-C motif) ligand 13 (CXCL13), mRNA
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 13
NCBI Official Symbol
CXCL13
NCBI Official Synonym Symbols
BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
NCBI Protein Information
C-X-C motif chemokine 13; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant)
UniProt Protein Name
C-X-C motif chemokine 13
UniProt Gene Name
CXCL13
UniProt Synonym Gene Names
BCA1; BLC; SCYB13; BCA-1
UniProt Entry Name
CXL13_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CXCL13 cxcl13 (Catalog #AAA81616) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C-X-C motif chemokine 13 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, SDS-PAGE. Researchers should empirically determine the suitability of the CXCL13 cxcl13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLEVYYTSLR CRCVQESSVF IPRRFIDRIQ ILPRGNGCPR KEIIVWKKNK SIVCVDPQAE WIQRMMEVLR KRS. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 13, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.