Cathepsin K Preproprotein (CTSK) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Cathepsin K (CTSK)
Gene Names
CTSK; CTSO; PKND; PYCD; CTS02; CTSO1; CTSO2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin K (CTSK); N/A; Recombinant Human Cathepsin K (CTSK); Cathepsin O; Cathepsin O2; Cathepsin X; CTSK recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
115-329aa; Full Length of Mature Protein
Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for CTSK recombinant protein
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
Product Categories/Family for CTSK recombinant protein
References
Molecular cloning of human cathepsin O, a novel endoproteinase and homologue of rabbit OC2.Shi G.-P., Chapman H.A., Bhairi S.M., Deleeuw C., Reddy V.Y., Weiss S.J.FEBS Lett. 357:129-134(1995)
Molecular cloning of human cDNA for cathepsin K
novel cysteine proteinase predominantly expressed in bone.Inaoka T., Bilbe G., Ishibashi O., Tezuka K., Kumegawa M., Kokubo T.Biochem. Biophys. Res. Commun. 206:89-96(1995)
Cloning and complete coding sequence of a novel human cathepsin expressed in giant cells of osteoclastomas.Li Y., Alexander M., Wucherpfennig A.L., Yelick P., Chen W., Stashenko P.J. Bone Miner. Res. 10:1197-1202(1995)
Human cathepsin O2, a novel cysteine protease highly expressed in osteoclastomas and ovary molecular cloning, sequencing and tissue distribution.Broemme D., Okamoto K.Biol. Chem. Hoppe-Seyler 376:379-384(1995)
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Crystal structure of human cathepsin K complexed with a potent inhibitor.McGrath M.E., Klaus J.L., Barnes M.G., Bromme D.Nat. Struct. Biol. 4:105-109(1997)
Design of potent and selective human cathepsin K inhibitors that span the active site.Thompson S.K., Halbert S.M., Bossard M.J., Tomaszek T.A., Levy M.A., Zhao B., Smith W.W., Abdel-Meguid S.S., Janson C.A., D'Alessio K.J., McQueney M.S., Amegadzie B.Y., Hanning C.R., Desjarlais R.L., Briand J., Sarkar S.K., Huddleston M.J., Ijames C.F., Carr S.A., Garnes K.T., Shu A., Heys J.R., Bradbeer J., Zembryki D., Veber D.F.Proc. Natl. Acad. Sci. U.S.A. 94:14249-14254(1997)
The crystal structure of human procathepsin K.LaLonde J.M., Zhao B., Janson C.A., D'Alessio K.J., McQueney M.S., Orsini M.J., Debouck C.M., Smith W.W.Biochemistry 38:862-869(1999)
Crystal structure of wild-type human procathepsin K.Sivaraman J., Lalumiere M., Menard R., Cygler M.Protein Sci. 8:283-290(1999)
Pycnodysostosis, a lysosomal disease caused by cathepsin K deficiency.Gelb B.D., Shi G.-P., Chapman H.A., Desnick R.J.Science 273:1236-1238(1996)
Paternal uniparental disomy for chromosome 1 revealed by molecular analysis of a patient with pycnodysostosis.Gelb B.D., Willner J.P., Dunn T.M., Kardon N.B., Verloes A., Poncin J., Desnick R.J.Am. J. Hum. Genet. 62:848-854(1998)
Mutations of CTSK result in pycnodysostosis via a reduction in cathepsin K protein.Ho N., Punturieri A., Wilkin D., Szabo J., Johnson M., Whaley J., Davis J., Clark A., Weiss S., Francomano C.J. Bone Miner. Res. 14:1649-1653(1999)
Cathepsin K gene mutations and 1q21 haplotypes in at patients with pycnodysostosis in an outbred population.Haagerup A., Hertz J.M., Christensen M.F., Binderup H., Kruse T.A.Eur. J. Hum. Genet. 8:431-436(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25.5 kDa
NCBI Official Full Name
cathepsin K preproprotein
NCBI Official Synonym Full Names
cathepsin K
NCBI Official Symbol
CTSK
NCBI Official Synonym Symbols
CTSO; PKND; PYCD; CTS02; CTSO1; CTSO2
NCBI Protein Information
cathepsin K
UniProt Protein Name
Cathepsin K
UniProt Gene Name
CTSK
UniProt Synonym Gene Names
CTSO; CTSO2
UniProt Entry Name
CATK_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The CTSK ctsk (Catalog #AAA18463) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 115-329aa; Full Length of Mature Protein. The amino acid sequence is listed below: APDSVDYRKK GYVTPVKNQG QCGSCWAFSS VGALEGQLKK KTGKLLNLSP QNLVDCVSEN DGCGGGYMTN AFQYVQKNRG IDSEDAYPYV GQEESCMYNP TGKAAKCRGY REIPEGNEKA LKRAVARVGP VSVAIDASLT SFQFYSKGVY YDESCNSDNL NHAVLAVGYG IQKGNKHWII KNSWGENWGN KGYILMARNK NNACGIANLA SFPKM . It is sometimes possible for the material contained within the vial of "Cathepsin K (CTSK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
