Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell CssIV Recombinant Protein – Cat# AAA114645 – SDS-PAGE SDS-PAGE

Beta-Mammal Toxin Css4 (CssIV) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-mammal toxin Css4; N/A; Recombinant Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4; CssIV recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-85aa;Full Length of Mature Protein
Sequence
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell CssIV Recombinant Protein – Cat# AAA114645 – SDS-PAGE SDS-PAGE
Related Product Information for CssIV recombinant protein
Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
References
Scorpion toxins specific for Na+-channels.Possani L.D., Becerril B., Delepierre M., Tytgat J.Eur. J. Biochem. 264:287-300(1999) Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusus.Martin M.-F., Garcia Y., Perez L.G., el Ayeb M., Kopeyan C., Bechis G., Jover E., Rochat H.J. Biol. Chem. 262:4452-4459(1987) Voltage sensor-trapping enhanced activation of sodium channels by beta-scorpion toxin bound to the S3-S4 loop in domain II.Cestele S., Qu Y., Rogers J.C., Rochat H., Scheuer T., Catterall W.A.Neuron 21:919-931(1998) Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001) Common features in the functional surface of scorpion beta-toxins and elements that confer specificity for insect and mammalian voltage-gated sodium channels.Cohen L., Karbat I., Gilles N., Ilan N., Benveniste M., Gordon D., Gurevitz M.J. Biol. Chem. 280:5045-5053(2005) X-ray structure and mutagenesis of the scorpion depressant toxin LqhIT2 reveals key determinants crucial for activity and anti-insect selectivity.Karbat I., Turkov M., Cohen L., Kahn R., Gordon D., Gurevitz M., Frolow F.J. Mol. Biol. 366:586-601(2007)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
23.6 kDa
NCBI Official Full Name
Beta-mammal toxin Css4
UniProt Protein Name
Beta-mammal toxin Css4
UniProt Gene Name
CssIV
UniProt Synonym Gene Names
CssIV
UniProt Entry Name
SCX4_CENSU

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CssIV cssiv (Catalog #AAA114645) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-85aa;Full Length of Mature Protein. The amino acid sequence is listed below: KEGYLVNSYT GCKFECFKLG DNDYCLRECR QQYGKGSGGY CYAFGCWCTH LYEQAVVWPL PNKTCN. It is sometimes possible for the material contained within the vial of "Beta-mammal toxin Css4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.