Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
HEK293 Cells COVID-19 Recombinant Protein – Cat# AAA62225 – SDS-PAGE SDS-PAGE (SDS-PAGE: purified spike SARS-CoV-2 S1 protein of the UK variant)

COVID 19 Spike S1 Protein (UK Variant B.1.1.7) Coronavirus (COVID-19) HEK293 Cells Recombinant Protein

Spike S1 Protein (SARS-CoV-2 UK Variant B.1.1.7)

Average rating 0.0
No ratings yet
Applications
ELISA, Western Blot
Purity
>= 95% (SDS-PAGE)
Synonyms
COVID 19 Spike S1 Protein (UK Variant B.1.1.7) Coronavirus; N/A; Spike S1 Protein (SARS-CoV-2 UK Variant B.1.1.7); 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Spike S1 Protein (UK Variant B.1.1.7); COVID-19 recombinant protein
Ordering

Product Overview

Host
HEK293 Cells
Purity/Purification
>= 95% (SDS-PAGE)
Form/Format
50 ug in PBS, pH7.4
Concentration
50 ug in PBS, pH7.4 (varies by lot)
Sequence Positions
16-683
Sequence
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAISGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIDDTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNSYECDIPIGAGICASYQTQTNSPRRARHHHHHHHH
Applicable Applications for COVID-19 recombinant protein
ELISA, WB (Western Blot)
Source Note
HEK-293 expressed recombinant SARS-CoV-2 S1 protein of the UK variant B.1.1.7
Viral Protein
SARS-CoV-2 S1 protein (amino acid 16-683) of the UK variant B.1.1.7 (GenBank Accession No. MW422256) with a C-terminal poly his-tag
Endotoxin
<0.01 EU per ug of purified protein by LAL test
Dry Ice Note
The product may be shipped with dry ice, and an additional fee may be added to your shipping cost.
Preparation and Storage
Store at -20 degree C; Stable for 6-months from the date of shipment when kept at 4 degree C. Non-hazardous, no MSDS required

SDS-PAGE

(SDS-PAGE: purified spike SARS-CoV-2 S1 protein of the UK variant)

HEK293 Cells COVID-19 Recombinant Protein – Cat# AAA62225 – SDS-PAGE SDS-PAGE (SDS-PAGE: purified spike SARS-CoV-2 S1 protein of the UK variant)
Related Product Information for COVID-19 recombinant protein
C-terminal His-tagged, HEK293 expressed.
C-terminal his-tagged recombinant SARS-CoV-2 S1 protein (aa 16-683) of the UK variant B.1.1.7 (GenBank Accession No. MW422256)

The novel coronavirus (SARS-CoV-2), previously called 2019-nCoV, is a newly identified coronavirus causing the ongoing outbreak of atypical pneumonia in Wuhan China from late 2019.

The genome of SARS-CoV-2 has 89% nucleotide identity with bat SARS-like-CoVZXC21 and 82% with that of human SARS-CoV. The phylogenetic trees of their orf1a/b, Spike, Envelope, Membrane and Nucleocapsid protein also clustered closely with those of the bat, civet and human SARS coronaviruses. However, the external subdomain of Spike's receptor binding domain (RBD) of SARS-CoV-2 shares only 40% amino acid identity with other SARS-related coronaviruses.

Recombinant SARS-CoV-2 S1 protein of the UK variant B.1.1.7 purified from 293 cells

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The COVID-19 (Catalog #AAA62225) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-683. AAA Biotech's COVID 19 Spike S1 Protein (UK Variant B.1.1.7) Coronavirus can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the COVID-19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VNLTTRTQLP PAYTNSFTRG VYYPDKVFRS SVLHSTQDLF LPFFSNVTWF HAISGTNGTK RFDNPVLPFN DGVYFASTEK SNIIRGWIFG TTLDSKTQSL LIVNNATNVV IKVCEFQFCN DPFLGVYKNN KSWMESEFRV YSSANNCTFE YVSQPFLMDL EGKQGNFKNL REFVFKNIDG YFKIYSKHTP INLVRDLPQG FSALEPLVDL PIGINITRFQ TLLALHRSYL TPGDSSSGWT AGAAAYYVGY LQPRFLLKYN ENGTITDAVD CALDPLSETK CTLKSFTVEK GIYQTSNFRV QPTESIVRFP NITNLCPFGE VFNATRFASV YAWNRKRISN CVADYSVLYN SASFSTFKCY GVSPTKLNDL CFTNVYADSF VRGDEVRQIA PGQTGKIADY NYKLPDDFTG CVIAWNSNNL DSKVGGNYNY LYRLFRKSNL KPFERDISTE IYQAGSTPCN GVEGFNCYFP LQSYGFQPTY GVGYQPYRVV VLSFELLHAP ATVCGPKKTN LVKNKCVNFN FNGLTGTGVL TESNKKFLPF QQFGRDIDDT TDAVRDPQTL EILDITPCSF GGVSVITPGT NTSNQVAVLY QGVNCTEVPV AIHADQLTPT WRVYSTGSNV FQTRAGCLIG AEHVNSYECD IPIGAGICAS YQTQTNSPRR ARHHHHHHHH. It is sometimes possible for the material contained within the vial of "COVID 19 Spike S1 Protein (UK Variant B.1.1.7) Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.