Collagen alpha-1(XVIII) chain Recombinant Protein | COL18A1 recombinant protein

Recombinant Human Collagen alpha-1(XVIII) chain

Cat. Num. AAA113448

• Gene Names: COL18A1; KS; KNO; KNO1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Collagen alpha-1(XVIII) chain; N/A; Recombinant Human Collagen alpha-1(XVIII) chain; COL18A1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1578-1754aa; Partial
• Sequence: QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for COL18A1 recombinant protein

COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.

Product Categories/Family for COL18A1 recombinant protein

Cell adhesion

References

Complete primary structure of two variant forms of human type XVIII collagen and tissue-specific differences in the expression of the corresponding transcripts.Saarela J., Ylikarppa R., Rehn M., Purmonen S., Pihlajaniemi T.Matrix Biol. 16:319-328(1998) Characterization of the human type XVIII collagen gene and proteolytic processing and tissue location of the variant containing a frizzled motif.Elamaa H., Snellman A., Rehn M., Autio-Harmainen H., Pihlajaniemi T.Matrix Biol. 22:427-442(2003) The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000) Cloning of cDNA and genomic DNA encoding human type XVIII collagen and localization of the alpha 1(XVIII) collagen gene to mouse chromosome 10 and human chromosome 21.Oh S.P., Warman M.L., Seldin M.F., Cheng S., Knoll J.H., Timmons S., Olsen B.R.Genomics 19:494-499(1994) Inhibition effect in vitro of purified endostatin expressed in Pichia pastoris.Feng Y., Cui L.B., Liu C.X., Ma Q.J.Sheng Wu Gong Cheng Xue Bao 17:278-282(2001) Cloning and expression of human endostatin gene in Escherichia coli.Zhi-Yong H., Biao L., Wei-Jie Z., Xiang-Fu W. Endostatin promotes delayed secondary damage following traumatic brain injury.Deininger M.H., Trautmann K., Schluesener H.J.No evidence for locus heterogeneity in Knobloch syndrome.Aldahmesh M.A., Khan A.O., Mohamed J.Y., Levin A.V., Wuthisiri W., Lynch S., McCreery K., Alkuraya F.S.J. Med. Genet. 50:565-566(2013) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Zinc-dependent dimers observed in crystals of human endostatin.Ding Y.-H., Javaherian K., Lo K.-M., Chopra R., Boehm T., Lanciotti J., Harris B.A., Li Y., Shapiro R., Hohenester E., Timpl R., Folkman J., Wiley D.C.Proc. Natl. Acad. Sci. U.S.A. 95:10443-10448(1998) Collagen XVIII, containing an endogenous inhibitor of angiogenesis and tumor growth, plays a critical role in the maintenance of retinal structure and in neural tube closure.Sertie A.L., Sossi V., Camargo A.A., Zatz M., Brahe C., Passos-Bueno M.R.Hum. Mol. Genet. 9:2051-2058(2000) A polymorphism in endostatin, an angiogenesis inhibitor, predisposes for the development of prostatic adenocarcinoma.Iughetti P., Suzuki O., Godoi P.H., Alves V.A., Sertie A.L., Zorick T., Soares F., Camargo A.A., Moreira E.S., di Loreto C., Moreira-Filho C.A., Simpson A., Oliva G., Passos-Bueno M.R.Cancer Res. 61:7375-7378(2001) Knobloch syndrome novel mutations in COL18A1, evidence for genetic heterogeneity, and a functionally impaired polymorphism in endostatin.Menzel O., Bekkeheien R.C.J., Reymond A., Fukai N., Boye E., Kosztolanyi G., Aftimos S., Deutsch S., Scott H.S., Olsen B.R., Antonarakis S.E., Guipponi M.Hum. Mutat. 23:77-84(2004) DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K., Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L., Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A., Abbott S., Locke D., Hillier L.W., Miner T., Fulton L., Magrini V., Wylie T., Glasscock J., Conyers J., Sander N., Shi X., Osborne J.R., Minx P., Gordon D., Chinwalla A., Zhao Y., Ries R.E., Payton J.E., Westervelt P., Tomasson M.H., Watson M., Baty J., Ivanovich J., Heath S., Shannon W.D., Nagarajan R., Walter M.J., Link D.C., Graubert T.A., DiPersio J.F., Wilson R.K.Nature 456:66-72(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 110611235
• NCBI GeneID: 80781
• NCBI Accession #: NP_085059.2
• NCBI GenBank Nucleotide #: NM_030582.3
• UniProt Accession #: P39060; Q58EX6; Q6RZ39; Q6RZ40; Q6RZ41; Q8N4S4; Q8WXI5; Q96T70; Q9UK38; Q9Y6Q7; Q9Y6Q8; A8MVI4
• Molecular Weight: 21.3 kDa
• NCBI Official Full Name: collagen alpha-1(XVIII) chain isoform 1 preproprotein
• NCBI Official Synonym Full Names: collagen type XVIII alpha 1
• NCBI Official Symbol: COL18A1
• NCBI Official Synonym Symbols: KS; KNO; KNO1
• NCBI Protein Information: collagen alpha-1(XVIII) chain
• UniProt Protein Name: Collagen alpha-1(XVIII) chain
• UniProt Gene Name: COL18A1
• UniProt Entry Name: COIA1_HUMAN