C-C motif chemokine 25 Recombinant Protein | Ccl25 recombinant protein
Recombinant Mouse C-C motif chemokine 25
Gene Names
Ccl25; TECK; CKb15; Scya25; AI852536; A130072A22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 25; N/A; Recombinant Mouse C-C motif chemokine 25; Chemokine TECK; Small-inducible cytokine A25; Thymus-expressed chemokine; Ccl25 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-144. Partial.
Sequence
GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Sequence Length
144
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Ccl25 recombinant protein
Potentially involved in T-cell development. Recombinant protein shows chotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
References
TECK a novel CC chemokine specifically expressed by thymic dendritic cells and potentially involved in T cell development.Vicari A.P., Figueroa D.J., Hedrick J.A., Foster J.S., Singh K.P., Menon S., Copeland N.G., Gilbert D.J., Jenkins N.A., Bacon K.B., Zlotnik A.Immunity 7:291-301(1997) The chemokine TECK is expressed by thymic and intestinal epithelial cells and attracts double- and single-positive thymocytes expressing the TECK receptor CCR9.Wurbel M.A., Philippe J.-M., Nguyen C., Victorero G., Freeman T., Wooding P., Miazek A., Mattei M.-G., Malissen M., Jordan B.R., Malissen B., Carrier A., Naquet P.3.3.CO;2-S>Eur. J. Immunol. 30:262-271(2000) Functional characterization of the CCL25 promoter in small intestinal epithelial cells suggests a regulatory role for caudal-related homeobox (Cdx) transcription factors.Ericsson A., Kotarsky K., Svensson M., Sigvardsson M., Agace W.J. Immunol. 176:3642-3651(2006) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18 kDa
NCBI Official Full Name
C-C motif chemokine 25
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 25
NCBI Official Symbol
Ccl25
NCBI Official Synonym Symbols
TECK; CKb15; Scya25; AI852536; A130072A22Rik
NCBI Protein Information
C-C motif chemokine 25
UniProt Protein Name
C-C motif chemokine 25
UniProt Gene Name
Ccl25
UniProt Synonym Gene Names
Scya25; Teck
UniProt Entry Name
CCL25_MOUSE
Similar Products
Product Notes
The Ccl25 ccl25 (Catalog #AAA116173) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-144. Partial. The amino acid sequence is listed below: GAFEDCCLGY QHRIKWNVLR HARNYHQQEV SGSCNLRAVR FYFRQKVVCG NPEDMNVKRA MRILTARKRL VHWKSASDSQ TERKKSNHMK SKVENPNSTS VRSATLGHPR MVMMPRKTNN. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 25, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
