Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell CA1 Recombinant Protein – Cat# AAA113247 – SDS-PAGE SDS-PAGE

Carbonic Anhydrase 1 Isoform A (CA1) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human Carbonic anhydrase 1

Average rating 0.0
No ratings yet
Gene Names
CA1; CAB; CA-I; Car1; HEL-S-11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic anhydrase 1; N/A; Recombinant Human Carbonic anhydrase 1; Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I; CA1 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-261aa; Full Length of Mature Protein
Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell CA1 Recombinant Protein – Cat# AAA113247 – SDS-PAGE SDS-PAGE
Related Product Information for CA1 recombinant protein
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Product Categories/Family for CA1 recombinant protein
References
Human carbonic anhydrase I cDNA.Barlow J.H., Lowe N., Edwards Y.H., Butterworth P.H.W.Nucleic Acids Res. 15:2386-2386(1987) Structure and methylation patterns of the gene encoding human carbonic anhydrase I.Lowe N., Brady H.J.M., Barlow J.H., Sowden J.C., Edwards M., Butterworth P.H.W.Gene 93:277-283(1990) Primary structure of human B erythrocyte carbonic anhydrase. 3. Sequence of CNBr fragment I and III (residues 149-260) .Giraud N., Marriq C., Laurent-Tabusse G.Biochimie 56:1031-1043(1974) Amino acid sequence of human erythrocyte carbonic anhydrase B.Andersson B., Nyman P.O., Strid L.Biochem. Biophys. Res. Commun. 48:670-677(1972) Human carbonic anhydrases. XI. The complete primary structure of carbonic anhydrase B.Lin K.-T.D., Deutsch H.F.J. Biol. Chem. 248:1885-1893(1973) Human carbonic anhydrases. XII. The complete primary structure of the C isozyme.Lin K.-T.D., Deutsch H.F.J. Biol. Chem. 249:2329-2337(1974) Carbonic anhydrase catalyzes cyanamide hydration to urea is it mimicking the physiological reaction?Briganti F., Mangani S., Scozzafava A., Vernaglione G., Supuran C.T.J. Biol. Inorg. Chem. 4:528-536(1999) Carbonic anhydrase activators. Activation of isozymes I, II, IV, VA, VII, and XIV with l- and d-histidine and crystallographic analysis of their adducts with isoform II engineering proton-transfer processes within the active site of an enzyme.Temperini C., Scozzafava A., Vullo D., Supuran C.T.Chemistry 12:7057-7066(2006) Carbonic anhydrase activators. Activation of isoforms I, II, IV, VA, VII, and XIV with L- and D-phenylalanine and crystallographic analysis of their adducts with isozyme II stereospecific recognition within the active site of an enzyme and its consequences for the drug design.Temperini C., Scozzafava A., Vullo D., Supuran C.T.J. Med. Chem. 49:3019-3027(2006) Carbonic anhydrase activators L-Adrenaline plugs the active site entrance of isozyme II, activating better isoforms I, IV, VA, VII, and XIV.Temperini C., Innocenti A., Scozzafava A., Mastrolorenzo A., Supuran C.T.Bioorg. Med. Chem. Lett. 17:628-635(2007) A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.Crocetti L., Maresca A., Temperini C., Hall R.A., Scozzafava A., Muehlschlegel F.A., Supuran C.T.Bioorg. Med. Chem. Lett. 19:1371-1375(2009) Non-zinc mediated inhibition of carbonic anhydrases coumarins are a new class of suicide inhibitors.Maresca A., Temperini C., Vu H., Pham N.B., Poulsen S.-A., Scozzafava A., Quinn R.J., Supuran C.T.J. Am. Chem. Soc. 131:3057-3062(2009) Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.Di Fiore A., Monti S.M., Hilvo M., Parkkila S., Romano V., Scaloni A., Pedone C., Scozzafava A., Supuran C.T., De Simone G.Proteins 74:164-175(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structure of human carbonic anhydrase B. I. Crystallization and heavy atom modifications.Kannan K.K., Fridborg K., Bergsten P.C., Liljas A., Loevgren S., Petef M., Strandberg B., Waara I., Adler L., Falkbring S.O., Goethe P.O., Nyman P.O.J. Mol. Biol. 63:601-604(1972) Crystal structure of human erythrocyte carbonic anhydrase B. Three-dimensional structure at a nominal 2.2-A resolution.Kannan K.K., Notstrand B., Fridborg K., Loevgren S., Ohlsson A., Petef M.Proc. Natl. Acad. Sci. U.S.A. 72:51-55(1975) Structure, refinement, and function of carbonic anhydrase isozymes refinement of human carbonic anhydrase I.Kannan K.K., Ramanadham M., Jones T.A.Ann. N. Y. Acad. Sci. 429:49-60(1984) Differences in anionic inhibition of human carbonic anhydrase I revealed from the structures of iodide and gold cyanide inhibitor complexes.Kumar V., Kannan K.K., Sathyamurthi P.Acta Crystallogr. D 50:731-738(1994) Enzyme-substrate interactions. Structure of human carbonic anhydrase I complexed with bicarbonate.Kumar V., Kannan K.K.J. Mol. Biol. 241:226-232(1994) Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.Chakravarty S., Kannan K.K.J. Mol. Biol. 243:298-309(1994) Crystal structure of a zinc-activated variant of human carbonic anhydrase I, CA I Michigan 1 evidence for a second zinc binding site involving arginine coordination.Ferraroni M., Tilli S., Briganti F., Chegwidden W.R., Supuran C.T., Wiebauer K.E., Tashian R.E., Scozzafava A.Biochemistry 41:6237-6244(2002) Carbonic anhydrase activators the first X-ray crystallographic study of an adduct of isoform I.Temperini C., Scozzafava A., Supuran C.T.Bioorg. Med. Chem. Lett. 16:5152-5156(2006) Ultrahigh resolution crystal structures of human carbonic anhydrases I and II complexed with 'two-prong' inhibitors reveal the molecular basis of high affinity.Jude K.M., Banerjee A.L., Haldar M.K., Manokaran S., Roy B., Mallik S., Srivastava D.K., Christianson D.W.J. Am. Chem. Soc. 128:3011-3018(2006) Phosph(on) ate as a zinc-binding group in metalloenzyme inhibitors X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.Temperini C., Innocenti A., Guerri A., Scozzafava A., Rusconi S., Supuran C.T.Bioorg. Med. Chem. Lett. 17:2210-2215(2007) Structural analysis of charge discrimination in the binding of inhibitors to human carbonic anhydrases I and II.Srivastava D.K., Jude K.M., Banerjee A.L., Haldar M., Manokaran S., Kooren J., Mallik S., Christianson D.W.J. Am. Chem. Soc. 129:5528-5537(2007) Population genetic studies of the Philippine Negritos. III. Identification of the carbonic anhydrase-1 variant with CA1 Guam.Omoto K., Ueda S., Goriki K., Takahashi N., Misawa S., Pagaran I.G.Am. J. Hum. Genet. 33:105-111(1981) Marked zinc activation of ester hydrolysis by a mutation, 67-His (CAT) to Arg (CGT) , in the active site of human carbonic anhydrase I.Chegwidden W.R., Wagner L.E., Venta P.J., Bergenhem N.C.H., Yu Y.-S.L., Tashian R.E.Hum. Mutat. 4:294-296(1994)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
759
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.7 kDa
NCBI Official Full Name
carbonic anhydrase 1 isoform a
NCBI Official Synonym Full Names
carbonic anhydrase I
NCBI Official Symbol
CA1
NCBI Official Synonym Symbols
CAB; CA-I; Car1; HEL-S-11
NCBI Protein Information
carbonic anhydrase 1
UniProt Protein Name
Carbonic anhydrase 1
UniProt Gene Name
CA1
UniProt Synonym Gene Names
CAB; CA-I
UniProt Entry Name
CAH1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CA1 ca1 (Catalog #AAA113247) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-261aa; Full Length of Mature Protein. The amino acid sequence is listed below: ASPDWGYDDK NGPEQWSKLY PIANGNNQSP VDIKTSETKH DTSLKPISVS YNPATAKEII NVGHSFHVNF EDNDNRSVLK GGPFSDSYRL FQFHFHWGST NEHGSEHTVD GVKYSAELHV AHWNSAKYSS LAEAASKADG LAVIGVLMKV GEANPKLQKV LDALQAIKTK GKRAPFTNFD PSTLLPSSLD FWTYPGSLTH PPLYESVTWI ICKESISVSS EQLAQFRSLL SNVEGDNAVP MQHNNRPTQP LKGRTVRASF. It is sometimes possible for the material contained within the vial of "Carbonic anhydrase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.