Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell C1qtnf3 Recombinant Protein – Cat# AAA18757 – SDS-PAGE SDS-PAGE

Complement C1Q Tumor Necrosis Factor-Related Protein 3 Isoform 2 (C1qtnf3) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

Average rating 0.0
No ratings yet
Gene Names
C1qtnf3; Cors; CTRP3; Corcs; CORS26; CORS-26; 2310005P21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3); N/A; Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3); C1qtnf3 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-246. Full Length of Mature Protein
Sequence
QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell C1qtnf3 Recombinant Protein – Cat# AAA18757 – SDS-PAGE SDS-PAGE
Product Categories/Family for C1qtnf3 recombinant protein
References
"Role of specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 in transcriptional regulation of the murine CORS-26 promoter." Schaffler A., Ehling A., Neumann E., Herfarth H., Paul G., Tarner I., Gay S., Buechler C., Scholmerich J., Muller-Ladner U. Biochim. Biophys. Acta 1678:150-156(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.6 kDa
NCBI Official Full Name
complement C1q tumor necrosis factor-related protein 3 isoform 2
NCBI Official Synonym Full Names
C1q and tumor necrosis factor related protein 3
NCBI Official Symbol
C1qtnf3
NCBI Official Synonym Symbols
Cors; CTRP3; Corcs; CORS26; CORS-26; 2310005P21Rik
NCBI Protein Information
complement C1q tumor necrosis factor-related protein 3
UniProt Protein Name
Complement C1q tumor necrosis factor-related protein 3
UniProt Gene Name
C1qtnf3
UniProt Synonym Gene Names
Cors26; Ctrp3; CORS26

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The C1qtnf3 c1qtnf3 (Catalog #AAA18757) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-246. Full Length of Mature Protein. The amino acid sequence is listed below: QDEYMESPQA GGLPPDCSKC CHGDYGFRGY QGPPGPPGPP GIPGNHGNNG NNGATGHEGA KGEKGDKGDL GPRGERGQHG PKGEKGYPGV PPELQIAFMA SLATHFSNQN SGIIFSSVET NIGNFFDVMT GRFGAPVSGV YFFTFSMMKH EDVEEVYVYL MHNGNTVFSM YSYETKGKSD TSSNHAVLKL AKGDEVWLRM GNGALHGDHQ RFSTFAGFLL FETK . It is sometimes possible for the material contained within the vial of "Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.