Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell bla Recombinant Protein – Cat# AAA18777 – SDS-PAGE SDS-PAGE

MULTISPECIES: Carbapenem-Hydrolyzing Class A Beta-Lactamase KPC-2 (bla) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla)

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbapenem-hydrolyzing beta-lactamase KPC (bla); N/A; Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla); Carbapenem-hydrolyzing beta-lactamase KPC-2; bla recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-293aa; Full Length of Mature Protein
Sequence
LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
Species
Klebsiella oxytoca
Buffer
0.2 um Sterile Filtered PBS, pH 7.4, 20% glycerol
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell bla Recombinant Protein – Cat# AAA18777 – SDS-PAGE SDS-PAGE
Related Product Information for bla recombinant protein
Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.
References
"Carbapenem-resistant strain of Klebsiella oxytoca harboring carbapenem-hydrolyzing beta-lactamase KPC-2." Yigit H., Queenan A.M., Rasheed J.K., Biddle J.W., Domenech-Sanchez A., Alberti S., Bush K., Tenover F.C. Antimicrob. Agents Chemother. 47:3881-3889(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.5 kDa
NCBI Official Full Name
MULTISPECIES: carbapenem-hydrolyzing class A beta-lactamase KPC-2
NCBI Official Symbol
CFNIH1_RS25375
NCBI Protein Information
carbapenem-hydrolyzing class A beta-lactamase KPC-2
UniProt Protein Name
Carbapenem-hydrolyzing beta-lactamase KPC
UniProt Gene Name
bla
UniProt Synonym Gene Names
kpc; kpc2
UniProt Entry Name
BLKPC_KLEOX

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The bla bla (Catalog #AAA18777) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-293aa; Full Length of Mature Protein. The amino acid sequence is listed below: LTNLVAEPFA KLEQDFGGSI GVYAMDTGSG ATVSYRAEER FPLCSSFKGF LAAAVLARSQ QQAGLLDTPI RYGKNALVPW SPISEKYLTT GMTVAELSAA AVQYSDNAAA NLLLKELGGP AGLTAFMRSI GDTTFRLDRW ELELNSAIPG DARDTSSPRA VTESLQKLTL GSALAAPQRQ QFVDWLKGNT TGNHRIRAAV PADWAVGDKT GTCGVYGTAN DYAVVWPTGR APIVLAVYTR APNKDDKHSE AVIAAAARLA LEGLGVNGQ . It is sometimes possible for the material contained within the vial of "Carbapenem-hydrolyzing beta-lactamase KPC (bla), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.