SDS-PAGE
Baculoviral IAP repeat-containing protein 5 Recombinant Protein | Birc5 recombinant protein
Recombinant Mouse Baculoviral IAP repeat-containing protein 5
Gene Names
Birc5; Api4; TIAP; AAC-11; survivin40
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Baculoviral IAP repeat-containing protein 5; N/A; Recombinant Mouse Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; TIAP; Birc5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-140aa; Full Length
Sequence
MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA
Sequence Length
121
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Birc5 recombinant protein
Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movent to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.
References
Mammalian inhibitor of apoptosis (IAP) homolog.Uren A.G., Vaux D.L.Kobayashi K., Otaki M., Ogasawara T., Tokuhisa T. Three differentially expressed survivin cDNA variants encode proteins with distinct antiapoptotic functions.Conway E.M., Pollefeyt S., Cornelissen J., DeBaere I., Steiner-Mosonyi M., Ong K., Baens M., Collen D., Schuh A.C.Blood 95:1435-1442(2000) Crystal structure and mutagenic analysis of the inhibitor-of-apoptosis protein survivin.Muchmore S.W., Chen J., Jakob C., Zakula D., Matayoshi E.D., Wu W., Zhang H., Li F., Ng S.C., Altieri D.C.Mol. Cell 6:173-182(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18.3 kDa
NCBI Official Full Name
baculoviral IAP repeat-containing protein 5 isoform 3
NCBI Official Synonym Full Names
baculoviral IAP repeat-containing 5
NCBI Official Symbol
Birc5
NCBI Official Synonym Symbols
Api4; TIAP; AAC-11; survivin40
NCBI Protein Information
baculoviral IAP repeat-containing protein 5
UniProt Protein Name
Baculoviral IAP repeat-containing protein 5
UniProt Gene Name
Birc5
UniProt Synonym Gene Names
Api4; Iap4
UniProt Entry Name
BIRC5_MOUSE
Similar Products
Product Notes
The Birc5 birc5 (Catalog #AAA115944) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-140aa; Full Length. The amino acid sequence is listed below: MGAPALPQIW QLYLKNYRIA TFKNWPFLED CACTPERMAE AGFIHCPTEN EPDLAQCFFC FKELEGWEPD DNPIEEHRKH SPGCAFLTVK KQMEELTVSE FLKLDRQRAK NKIAKETNNK QKEFEETAKT TRQSIEQLAA. It is sometimes possible for the material contained within the vial of "Baculoviral IAP repeat-containing protein 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.