Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell ARPC2 Recombinant Protein – Cat# AAA81594 – SDS-PAGE SDS-PAGE

Actin-Related Protein 2/3 Complex Subunit 2 (ARPC2) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial

Average rating 0.0
No ratings yet
Gene Names
ARPC2; ARC34; PRO2446; p34-Arc; PNAS-139
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Actin-related protein 2/3 complex subunit 2 (ARPC2); N/A; Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial; Arp2/3 complex 34 kDa subunit; p34-AR; C; ARPC2 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-250aa; partial
Sequence
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDY
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell ARPC2 Recombinant Protein – Cat# AAA81594 – SDS-PAGE SDS-PAGE
Related Product Information for ARPC2 recombinant protein
Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Ses to contact the mother actin filament.
Product Categories/Family for ARPC2 recombinant protein
References
The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly.Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J.J. Cell Biol. 138:375-384(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55.5 kDa
NCBI Official Full Name
actin-related protein 2/3 complex subunit 2
NCBI Official Synonym Full Names
actin related protein 2/3 complex subunit 2
NCBI Official Symbol
ARPC2
NCBI Official Synonym Symbols
ARC34; PRO2446; p34-Arc; PNAS-139
NCBI Protein Information
actin-related protein 2/3 complex subunit 2
UniProt Protein Name
Actin-related protein 2/3 complex subunit 2
UniProt Gene Name
ARPC2
UniProt Synonym Gene Names
ARC34; p34-ARC
UniProt Entry Name
ARPC2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ARPC2 arpc2 (Catalog #AAA81594) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-250aa; partial. The amino acid sequence is listed below: MILLEVNNRI IEETLALKFE NAAAGNKPEA VEVTFADFDG VLYHISNPNG DKTKVMVSIS LKFYKELQAH GADELLKRVY GSFLVNPESG YNVSLLYDLE NLPASKDSIV HQAGMLKRNC FASVFEKYFQ FQEEGKEGEN RAVIHYRDDE TMYVESKKDR VTVVFSTVFK DDDDVVIGKV FMQEFKEGRR ASHTAPQVLF SHREPPLELK DTDAAVGDNI GYITFVLFPR HTNASARDNT INLIHTFRDY. It is sometimes possible for the material contained within the vial of "Actin-related protein 2/3 complex subunit 2 (ARPC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.