Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell AC1 Recombinant Protein – Cat# AAA114405 – SDS-PAGE SDS-PAGE

Replication-Associated Protein (AC1) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant African cassava mosaic virus Replication-associated protein

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replication-associated protein; N/A; Recombinant African cassava mosaic virus Replication-associated protein; 40.4 kDa protein; Protein AC1; Protein AL1; AC1 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-358aa; Full Length
Sequence
MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA
Sequence Length
358
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell AC1 Recombinant Protein – Cat# AAA114405 – SDS-PAGE SDS-PAGE
Related Product Information for AC1 recombinant protein
Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all giniviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities.
References
Nucleotide sequence of cassava latent virus DNA.Stanley J., Gay M.R.Nature 301:260-262(1983)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
42.3 kDa
NCBI Official Full Name
Replication-associated protein
UniProt Protein Name
Replication-associated protein
UniProt Gene Name
AC1
UniProt Synonym Gene Names
Rep
UniProt Entry Name
REP_CLVK

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The AC1 ac1 (Catalog #AAA114405) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-358aa; Full Length. The amino acid sequence is listed below: MRTPRFRIQA KNVFLTYPKC SIPKEHLLSF IQTLSLQSNP KFIKICRELH QNGEPHLHAL IQFEGKITIT NNRLFDCVHP SCSTSFHPNI QGAKSSSDVK SYLDKDGDTV EWGQFQIDGR SARGGQQSAN DAYAKALNSG SKSEALNVIR ELVPKDFVLQ FHNLNSNLDR IFQEPPAPYV SPFPCSSFDQ VPVEIEEWVA DNVRDSAARP WRPNSIVIEG DSRTGKTIWA RSLGPHNYLC GHLDLSPKVF NNAAWYNVID DVDPHYLKHF KEFMGSQRDW QSNTKYGKPV QIKGGIPTIF LCNPGPTSSY KEFLAEEKQE ALKAWALKNA IFITLTEPLY SGSNQSHSQT SQEASHPA. It is sometimes possible for the material contained within the vial of "Replication-associated protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.