Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA13293_SDS_PAGE.jpg SDS-PAGE

TNNC1 recombinant protein

Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1) Protein

Gene Names
TNNC1; TNC; TN-C; TNNC; CMD1Z; CMH13
Purity
> 90% as determined by SDS-PAGE
Synonyms
TNNC1; N/A; Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1) Protein; TNC; TroponinC, Cardiac; Troponin C Type 1, Slow.; TNNC1 recombinant protein
Ordering
Host
E. Coli AA 1-161
Purity/Purification
> 90% as determined by SDS-PAGE
Form/Format
PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH 7.4) added with 15% glycerol. The elution buffer contained 300 mM imidazole
Concentration
0.8 mg/ml (varies by lot)
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Sequence Length
1-161
Protein Residues
With N-Terminal 6*His-tag.
Source
Human
Usage
Centrifuge the standard vial at 6000-10000rpm for 30s
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommended to aliquot the protein into smaller quantities for optimal storage.
The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.
Avoid repeated freeze-thaw cycles.

SDS-PAGE

product-image-AAA13293_SDS_PAGE.jpg SDS-PAGE
Related Product Information for TNNC1 recombinant protein
Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: Tnl, which is inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of Tnl, thus allowing the interaction of actin with myosin, the hydrolysis at ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. using a human/rodent monochromosomal mapping panel, Song et al. (1996) mapped a human symbolized TNNC1 to chromosome 3 by PCR. Chromosome 3 somatic cell hybrids with various rearrangements were used for finer mapping to 3p21.3-p14.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted MW: 22 kDa
Observed MW: 22 kDa
NCBI Official Full Name
troponin C, slow skeletal and cardiac muscles
NCBI Official Synonym Full Names
troponin C1, slow skeletal and cardiac type
NCBI Official Symbol
TNNC1
NCBI Official Synonym Symbols
TNC; TN-C; TNNC; CMD1Z; CMH13
NCBI Protein Information
troponin C, slow skeletal and cardiac muscles
UniProt Protein Name
Troponin C, slow skeletal and cardiac muscles
UniProt Gene Name
TNNC1
UniProt Synonym Gene Names
TNNC; TN-C
UniProt Entry Name
TNNC1_HUMAN

Similar Products

Product Notes

The TNNC1 tnnc1 (Catalog #AAA13293) is a Recombinant Protein produced from E. Coli AA 1-161 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MDDIYKAAVE QLTEEQKNEF KAAFDIFVLG AEDGCISTKE LGKVMRMLGQ NPTPEELQEM IDEVDEDGSG TVDFDEFLVM MVRCMKDDSK GKSEEELSDL FRMFDKNADG YIDLDELKIM LQATGETITE DDIEELMKDG DKNNDGRIDY DEFLEFMKGV E. It is sometimes possible for the material contained within the vial of "TNNC1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.