Metalloproteinase Inhibitor 4 (TIMP4) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Bovine Metalloproteinase inhibitor 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase inhibitor 4; N/A; Recombinant Bovine Metalloproteinase inhibitor 4; Tissue inhibitor of metalloproteinases 4; TIMP-4; TIMP4 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-224aa; Full Length
Sequence
CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP
Sequence Length
224
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for TIMP4 recombinant protein
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor.
References
NIH - Mammalian Gene Collection (MGC) project Hosseini G.H., Pepper M.S.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24.5 kDa
NCBI Official Full Name
metalloproteinase inhibitor 4
NCBI Official Symbol
TIMP4
NCBI Protein Information
metalloproteinase inhibitor 4
UniProt Protein Name
Metalloproteinase inhibitor 4
UniProt Gene Name
TIMP4
UniProt Synonym Gene Names
TIMP-4
UniProt Entry Name
TIMP4_BOVIN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The TIMP4 timp4 (Catalog #AAA115001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-224aa; Full Length. The amino acid sequence is listed below: CSCAPAHPQQ HVCHSALAIR AKISSEKVVP ASTDPADPQK MIRYEIKQIK MFKGFEKVND IQYIYTPFDS SLCGVKLEAN SQKRYLLTGQ ILSDGKVFVH LCNYIEPWEN LSFLQRESLN HHYHLNCGCQ ITTCYAVPCT ISAPNECLWT DWLLERKLYG YQAQHYVCMK HVDGSCSWYQ GRLPLRKEFV DIIQP. It is sometimes possible for the material contained within the vial of "Metalloproteinase inhibitor 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
