Sodium Channel Protein Type 10 Subunit Alpha (Scn10a) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Rat Sodium channel protein type 10 subunit alpha (Scn10a) , partial
Gene Names
Scn10a; PN3; Nav1.8; Na(V)1.8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sodium channel protein type 10 subunit alpha (Scn10a); N/A; Recombinant Rat Sodium channel protein type 10 subunit alpha (Scn10a) , partial; Scn10a recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-125aa; Partial
Sequence
MELPFASVGTTNFRRFTPESLAEIEKQIAAHRAAKKARTKHRGQEDKGEKPRPQLDLKACNQLPKFYGELPAELVGEPLEDLDPFYSTHRTFMVLNKSRTISRFSATWALWLFSPFNLIRRTAIK
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
219,605 Da
NCBI Official Full Name
sodium channel protein type 10 subunit alpha
NCBI Official Synonym Full Names
sodium voltage-gated channel alpha subunit 10
NCBI Official Symbol
Scn10a
NCBI Official Synonym Symbols
PN3; Nav1.8; Na(V)1.8
NCBI Protein Information
sodium channel protein type 10 subunit alpha
UniProt Protein Name
Sodium channel protein type 10 subunit alpha
UniProt Gene Name
Scn10a
UniProt Synonym Gene Names
Sns; PN3
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Scn10a scn10a (Catalog #AAA233570) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-125aa; Partial. The amino acid sequence is listed below: MELPFASVGT TNFRRFTPES LAEIEKQIAA HRAAKKARTK HRGQEDKGEK PRPQLDLKAC NQLPKFYGEL PAELVGEPLE DLDPFYSTHR TFMVLNKSRT ISRFSATWAL WLFSPFNLIR RTAIK. It is sometimes possible for the material contained within the vial of "Sodium channel protein type 10 subunit alpha (Scn10a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.