Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

E3 Ubiquitin-Protein Ligase RING2 (RNF2) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human E3 ubiquitin-protein ligase RING2 (RNF2)

Average rating 0.0
No ratings yet
Gene Names
RNF2; BAP1; DING; BAP-1; HIPI3; RING2; RING1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RING2 (RNF2); N/A; Recombinant Human E3 ubiquitin-protein ligase RING2 (RNF2); RNF2 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-336, Full length protein
Sequence
SQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Sequence Length
335
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RNF2 recombinant protein
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. This protein is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2
CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,258 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RING2
NCBI Official Synonym Full Names
ring finger protein 2
NCBI Official Symbol
RNF2
NCBI Official Synonym Symbols
BAP1; DING; BAP-1; HIPI3; RING2; RING1B
NCBI Protein Information
E3 ubiquitin-protein ligase RING2
UniProt Protein Name
E3 ubiquitin-protein ligase RING2
UniProt Gene Name
RNF2
UniProt Synonym Gene Names
BAP1; DING; HIPI3; RING1B; HIP2-interacting protein 3; RING1b

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RNF2 rnf2 (Catalog #AAA116980) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-336, Full length protein. The amino acid sequence is listed below: SQAVQTNGTQ PLSKTWELSL YELQRTPQEA ITDGLEIVVS PRSLHSELMC PICLDMLKNT MTTKECLHRF CADCIITALR SGNKECPTCR KKLVSKRSLR PDPNFDALIS KIYPSRDEYE AHQERVLARI NKHNNQQALS HSIEEGLKIQ AMNRLQRGKK QQIENGSGAE DNGDSSHCSN ASTHSNQEAG PSNKRTKTSD DSGLELDNNN AAMAIDPVMD GASEIELVFR PHPTLMEKDD SAQTRYIKTS GNATVDHLSK YLAVRLALEE LRSKGESNQM NLDTASEKQY TIYIATASGQ FTVLNGSFSL ELVSEKYWKV NKPMELYYAP TKEHK. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RING2 (RNF2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.